Os01g0831000

From RiceWiki
Revision as of 08:48, 8 May 2014 by Lixiaoman13 (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

LAX PANICLE (LAX) is involved in the formation of all types of axillary meristems throughout the ontogeny of a rice plant. Ectopic LAX expression in rice caused pleiotropic effects, including dwarfing, an altered pattern of stem elongation, darker color, bending of the lamina joint, absence of the midribs of leaves, and severe sterility.

Mutation

In strong mutant alleles of the LAX locus, such as lax-2 and lax-3, the initiation of lateral spikelets is completely suppressed, and panicle branches are also severely reduced. On the other hand, the defects were observed only in the lateral spikelets in lax-1, lax-4, and lax-5, which are weak mutant alleles of LAX. An insertion of a retro transposon was detected in the lax-1 allele(as showed in fig1). The existence of a long deletion, which contains five predicted genes, PG1 to PG5, was identified in the lax-2 allele. A 59-bp region was deleted in lax-3. Amino acid substitutions were found in lax-4 and lax-5, R50D or A49T, respectively.

caption

Expression

LAX cDNA is 1,080-bp in length cloned by screening a cDNA library prepared from very young inflorescences. Sequencing of the LAX cDNA revealed that the LAX gene is intronless and encodes an ORF of 215 aa. It encodes a basic helix–loop–helix transcription factor and is expressed in the boundary between the shoot apical meristem and the region of new meristem formation. This pattern of LAX expression was repeatedly observed in every axillary meristem(as showed in fig2).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1.Graduate School of Agriculture and Life Science, University of Tokyo, Yayoi 1-1-1, Bunkyo, Tokyo 113-8657, Japan; 2.Research Institute for Bioresources,Okayama University, Chuou 2-20-1, Kurashiki, Okayama 710-0046, Japan; 3.CREST, Japan Science and Technology Corporation, Honcho 4-1-8,Kawaguchi, Saitama 332-0012, Japan; 4.Department of Bio-Science, Nara Institute of Science and Technology, Takayama 8916-5,Ikoma, Nara 630-0101, Japan.

References

Please input cited references here. 1.Komatsu, K., et al. (2003). "LAX and SPA: major regulators of shoot branching in rice." Proc Natl Acad Sci U S A 100(20): 11765-11770.

Structured Information

Gene Name

Os01g0831000

Description

Transcription factor LAX PANICLE

Version

NM_001051234.1 GI:115440838 GeneID:4327431

Length

1078 bp

Definition

Oryza sativa Japonica Group Os01g0831000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:37313995..37315072

Sequence Coding Region

37314110..37314757

Expression

GEO Profiles:Os01g0831000

Genome Context

<gbrowseImage1> name=NC_008394:37313995..37315072 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:37313995..37315072 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattag</cdnaseq>

Protein Sequence

<aaseq>MHDPRGFPIHPQPYHLHPTAGGLGEGRMRGGGRRRPGAKLSTDP QSVAARERRHRISDRFRVLRSLVPGGSKMDTVSMLEQAIHYVKFLKAQVTLHQAALVQ HEEGCQHADVAAAFSAADADLALELNHRHGGAGDDDAGMTTLEMAPMQEAVGYGDGPA HQMMQQALDPAGQLMMGGAHQLPPLPCCVFVQETDPSCYSVCNVHGEESGAQGSY</aaseq>

Gene Sequence

<dnaseqindica>116..763#caggggctgaaacaaacccagcacatttgtgtttgtacgcgcagctagctagccacgagcgcggatccatctcctagctagcgcaccatctatggatccataccacgactaaaacatgcatgacccacgcggcttccccatccacccgcagccgtaccacctccaccccacggccggcggcctcggcgagggcaggatgcggggcggcgggcggcggcgccccggcgccaagctctccaccgacccgcagagcgtggcggcgcgggagcggcggcaccggatcagcgaccgcttccgcgtgctccgcagcctcgtgccgggcggcagcaagatggacacggtgtccatgctggagcaggccatccactacgtcaagttcctcaaggcgcaggtcaccctgcaccaggccgcgctcgtgcagcacgaggagggctgccagcacgccgacgtcgccgcggcgttctccgccgccgacgccgatctggcccttgagctgaaccatcgccacggcggcgccggcgatgatgacgccgggatgacgacgctggagatggcgccgatgcaagaggcggtgggctacggcgacggcccggctcatcagatgatgcagcaagcgctcgatccagcggggcagctgatgatgggcggcgctcatcagctgcctcctttgccttgctgtgtcttcgtccaggagactgacccctcgtgctactcggtgtgcaatgtccacggtgaggagtctggtgcgcaaggatcttattagctagctagtgagacagtggcttgcttaggtagttaatttccttaagtatgctcgaatattggctctacccactagctgtctagctctacttagcttacctaggtcgtcaaccaatatattaccggttggtcatggtcccttaaattagctagactcttgatttctgtaagaatgcatatatgcatgcatggggttctgttggagcaatgcataacagagctttgttttacatgcatgcgtgcatgcttcctagatatcattctgaaatctgaacttgtttgctcgatcgcttaattgctatctcaccatttcggt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0831000, RefSeq:Os01g0831000