Os06g0610300

From RiceWiki
Revision as of 08:11, 11 May 2014 by Yonglejiang (talk | contribs) (=Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

The MOC1 gene plays an important role in the control of rice tillering, encoding a putative GRAS family nuclear protein that is expressed mainly in the axillary buds and functions to initiate axillary buds and to promote their outgrowth[1][2]. In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield. Besides, as an member of the plant-specific GRAS family proteins that function in diverse aspects of plant development, including signal transduction, meristem maintenance and development[3][4], and as transcription factors [5], MOC1 might also function as a transcription factor[1]. MOC1 is highly homologous with the tomato Lateral suppressor (Ls) gene[1]. Ls loss-of-function mutations cause a branchless phenotype owing to a failure in axillary meristem initiation[6]. These results suggest that both Ls and MOC1 function as positive regulators of lateral branching.

Mutation

To identify genes involved in the control of rice tillering, Li et al. have screened for mutants with altered tiller numbers from collections derived from spontaneous mutations or g-ray radiation and ethyl methanesulphonate (EMS) mutagenesis, and they found that moc1 plants nearly completely lose their tillering ability after a spontaneous moc1 mutant, producing only one main culm, in contrast to the multiple tillers in wild-type plants[1]. They amplified the corresponding ORF from moc1 and wild-type plants with polymerase chain reaction (PCR) and sequenced it. DNA sequence comparison revealed a 1.9-kb retrotransposon inserted in this ORF in the moc1 mutant. Confirmation of the retrotransposon-interrupted ORF as MOC1 was achieved by functional complementation[1]. Genetic analysis with reciprocal crosses between moc1 and wild-type plants revealed that moc1 possesses a recessive mutation in a single nuclear locus[1]. We can see the effects of moc1 mutant on rice tillering from the following picture 2.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Structured Information

Gene Name

Os06g0610300

Description

Conserved hypothetical protein

Version

NM_001064587.1 GI:115468905 GeneID:4341506

Length

626 bp

Definition

Oryza sativa Japonica Group Os06g0610300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:25189473..25190098

Sequence Coding Region

25189730..25189909

Expression

GEO Profiles:Os06g0610300

Genome Context

<gbrowseImage1> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtag</cdnaseq>

Protein Sequence

<aaseq>MQCETLTQLDQVWGVCLFLLQGSYLEAIINEDPTKGQNMRWLET WVCLVSIQPFKALRV</aaseq>

Gene Sequence

<dnaseqindica>258..437#attcactcatgagttaaaattttactcggagttaaattttaactcatgatgacgtaaacgaatctcggacgtccatttctcgatccaatggtagttttcaagttttcactacatatgtggtttgtactgtatattttcccttgcatctccatgtatctcaaaagttacatgagtggcacttgctactgtgcatgtagtatgtgtagcagctaggttataaatttctttatgtgtaacatgtgtgtgatgcatagtatatgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtaggctacactcggagagagaacacagagcagccgtccaaaccgtctgaaatgataacttactctaagctagtaggagtgctagtagtaccctctatatgtgcaattttattcgttaaaaaggtttccatgcatgcttttttagtttatcaatagcctaaaccttttgaattattaagagttaattagtccc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0610300, RefSeq:Os06g0610300

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  6. Cite error: Invalid <ref> tag; no text was provided for refs named ref6