Os06g0610300
Please input one-sentence summary here.
Contents
Annotated Information
Function
The MOC1 gene plays an important role in the control of rice tillering, encoding a putative GRAS family nuclear protein that is expressed mainly in the axillary buds and functions to initiate axillary buds and to promote their outgrowth[1][2]. In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield. Besides, as an member of the plant-specific GRAS family proteins that function in diverse aspects of plant development, including signal transduction, meristem maintenance and development[3][4], and as transcription factors [5], MOC1 might also function as a transcription factor[1]. MOC1 is highly homologous with the tomato Lateral suppressor (Ls) gene[1]. Ls loss-of-function mutations cause a branchless phenotype owing to a failure in axillary meristem initiation[6]. These results suggest that both Ls and MOC1 function as positive regulators of lateral branching.
Mutation
To identify genes involved in the control of rice tillering, Li et al. have screened for mutants with altered tiller numbers from collections derived from spontaneous mutations or g-ray radiation and ethyl methanesulphonate (EMS) mutagenesis, and they found that moc1 plants nearly completely lose their tillering ability after a spontaneous moc1 mutant, producing only one main culm, in contrast to the multiple tillers in wild-type plants[1]. They amplified the corresponding ORF from moc1 and wild-type plants with polymerase chain reaction (PCR) and sequenced it. DNA sequence comparison revealed a 1.9-kb retrotransposon inserted in this ORF in the moc1 mutant. Confirmation of the retrotransposon-interrupted ORF as MOC1 was achieved by functional complementation[1]. Genetic analysis with reciprocal crosses between moc1 and wild-type plants revealed that moc1 possesses a recessive mutation in a single nuclear locus[1]. We can see the effects of moc1 mutant on rice tillering from the following picture 2.
Expression
The MOC1 spatial and temporal expression patterns revealed by RNA in situ hybridization are consistent with the function of MOC1 for axillary meristem initiation and tiller bud formation. MOC1 expression is detectable in a small number of epidermal or subepidermal cells at the leaf axils before any visible morphological changes at the position where axillary meristems will initiate. Thereafter, MOC1 is mainly expressed in the protuberance and axillary meristem and extended to the entire tiller bud including the axillary leaf primordia and young leaves, whereas no signal could be observed in the shoot apical meristem (SAM) [1]. Slight overexpression of the MOC1 gene can increased tiller number and reduced plant height[1].
Primer Forward primer Reverse prime Gene amplication 5’ -TCGTTGTAGTAGCTCT GGTG-3’ 5’-CTAACTAGAGATCGAGTAGC-3’[1].
RT-PCR 5'-AGACGCTCGCCGTGAACT-3' 5'-GCCTTCACCCACTTCAAGA-3'[7].
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Structured Information
| Gene Name |
Os06g0610300 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001064587.1 GI:115468905 GeneID:4341506 |
| Length |
626 bp |
| Definition |
Oryza sativa Japonica Group Os06g0610300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:25189473..25190098 |
| Sequence Coding Region |
25189730..25189909 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtag</cdnaseq> |
| Protein Sequence |
<aaseq>MQCETLTQLDQVWGVCLFLLQGSYLEAIINEDPTKGQNMRWLET WVCLVSIQPFKALRV</aaseq> |
| Gene Sequence |
<dnaseqindica>258..437#attcactcatgagttaaaattttactcggagttaaattttaactcatgatgacgtaaacgaatctcggacgtccatttctcgatccaatggtagttttcaagttttcactacatatgtggtttgtactgtatattttcccttgcatctccatgtatctcaaaagttacatgagtggcacttgctactgtgcatgtagtatgtgtagcagctaggttataaatttctttatgtgtaacatgtgtgtgatgcatagtatatgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtaggctacactcggagagagaacacagagcagccgtccaaaccgtctgaaatgataacttactctaagctagtaggagtgctagtagtaccctctatatgtgcaattttattcgttaaaaaggtttccatgcatgcttttttagtttatcaatagcctaaaccttttgaattattaagagttaattagtccc</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 Cite error: Invalid
<ref>tag; no text was provided for refs namedref1 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref2 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref3 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref4 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref5 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref6 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref8