Os06g0610300

From RiceWiki
Revision as of 11:11, 11 May 2014 by Yonglejiang (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

The MOC1 gene plays an important role in the control of rice tillering, encoding a putative GRAS family nuclear protein that is expressed mainly in the axillary buds and functions to initiate axillary buds and to promote their outgrowth[1][2]. In the case of the rice plant, more tillering equates to more grain-bearing branches, hence a higher grain yield. Besides, as an member of the plant-specific GRAS family proteins that function in diverse aspects of plant development, including signal transduction, meristem maintenance and development[3][4], and as transcription factors [5], MOC1 might also function as a transcription factor[1]. MOC1 is highly homologous with the tomato Lateral suppressor (Ls) gene[1]. Ls loss-of-function mutations cause a branchless phenotype owing to a failure in axillary meristem initiation[6]. These results suggest that both Ls and MOC1 function as positive regulators of lateral branching.

“Figure 1. Development of primary tillers at the shoot apex of the main stem in a rice plant. ”(from reference [7]).

Mutation

To identify genes involved in the control of rice tillering, Li et al. have screened for mutants with altered tiller numbers from collections derived from spontaneous mutations or g-ray radiation and ethyl methanesulphonate (EMS) mutagenesis, and they found that moc1 plants nearly completely lose their tillering ability after a spontaneous moc1 mutant, producing only one main culm, in contrast to the multiple tillers in wild-type plants[1]. They amplified the corresponding ORF from moc1 and wild-type plants with polymerase chain reaction (PCR) and sequenced it. DNA sequence comparison revealed a 1.9-kb retrotransposon inserted in this ORF in the moc1 mutant. Confirmation of the retrotransposon-interrupted ORF as MOC1 was achieved by functional complementation[1]. Genetic analysis with reciprocal crosses between moc1 and wild-type plants revealed that moc1 possesses a recessive mutation in a single nuclear locus[1]. We can see the effects of moc1 mutant on rice tillering from the following picture 2.

Expression

The MOC1 spatial and temporal expression patterns revealed by RNA in situ hybridization are consistent with the function of MOC1 for axillary meristem initiation and tiller bud formation. MOC1 expression is detectable in a small number of epidermal or subepidermal cells at the leaf axils before any visible morphological changes at the position where axillary meristems will initiate. Thereafter, MOC1 is mainly expressed in the protuberance and axillary meristem and extended to the entire tiller bud including the axillary leaf primordia and young leaves, whereas no signal could be observed in the shoot apical meristem (SAM) [1]. Slight overexpression of the MOC1 gene can increased tiller number and reduced plant height[1].

Primer Forward primer Reverse primer
Gene amplication 5’ -TCGTTGTAGTAGCTCT GGTG-3’ 5’-CTAACTAGAGATCGAGTAGC-3'[1]
RT-PCR 5'-AGACGCTCGCCGTGAACT-3' 5'-GCCTTCACCCACTTCAAGA-3'[8]

Evolution

MONOCULM1(MOC1) genomic regions were sequenced and compared across 14 Oryza genomes by Lu et al, and the result of genomic alignment of the MOC1 region in 18 Oryza genomes or subgenomes can be seen from Fig.3[2].


Sequencing and annotation of the MOC1 region of the 14 Oryza species, including 10 diploids and 4 allotetraploids, revealed highly conserved gene colinearity and structure in the MOC1 region[2]. Large and apparently noncoding sequences flanking the MOC1 gene were observed to be under strong purifying selection[2]. MOC1 is highly homologous with the tomato Lateral suppressor (Ls) gene. Rice MONOCULM1 (MOC1) and Arabidopsis LATERAL SUPPRESSOR (LAS) are orthologs, which play important roles in axillary meristems initiation in rice and Arabidopsis[1][9].

Knowledge Extension

TEOSINTE BRANCHED1 (TB1) encodes a putative transcription factor of the TCP protein family, and impairment of TB1 leading to enhance lateral branching in maize suggests its negative regulatory role in controlling the axillary bud outgrowth[10][11]. The rice ortholog OsTB1/FINE CULM1 (FC1) shows similar characteristics and therefore also negatively regulates rice tillering [12]. Consistent with the function of TB1 in maize, overexpression of OsTB1 reduces rice tillers severely while its loss-of-function mutation in the classical mutant fine culm (fcn1) promotes the outgrowth of rice tillers[7]. The results reveal that the pivotal role of OsTB1 is to control the outgrowth of rice tiller buds rather than the initiation of tiller buds[12]. D10 also functions as a negative regulator and works independently of OsTB1/FC1 in rice[13].

Labs working on this gene

  • Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • China National Rice Research Institute, Chinese Academy of Agricultural Sciences, Hangzhou 310006, Zhejiang, China
  • China Agricultural University, Beijing 100094, China
  • Institute of Plant Physiology and Ecology, Chinese Academy of Sciences,
  • Shanghai 200032, China
  • National Center for Gene Research, Chinese Academy of Sciences, Shanghai 200233, China
  • The National Center for Agricultural Biodiversity, Ministry of Education Key Laboratory of Agricultural Biodiversity for Plant Disease Management,Key *Laboratory of Plant Pathology, Yunnan Agricultural University, Kunming, 650201
  • State Key Laboratory of Plant Genomics, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China; bArizona
  • Genomics Institute, Department of Plant Sciences, BIO5 Institute, University of Arizona, Tucson, AZ 85721; cDepartment of Agronomy, Purdue University,West *Lafayette, IN 47907
  • Shanghai Key Laboratory of Bio-energy Crop, School of Life Sciences, Shanghai University, Shanghai 200444, China;
  • Department of Genetics, University of Georgia, Athens, GA 30602-7223

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 1.8 1.9 Li X, Qian Q, Fu Z, Wang Y, Xiong G, Zeng D, Wang X, Liu X, Teng S, Hiroshi F et al. Control of tillering in rice[J]. Nature 2003, 422:618-621.
  2. 2.0 2.1 2.2 2.3 Fei Lua,1, Jetty S. S. Ammirajub,1, Abhijit Sanyalc,1, Shengli Zhanga,1,2, Rentao Song, et al. Comparative sequence analysis of MONOCULM1-orthologous regions in 14 Oryza genomes[J]. PNAS. 2009, 106 (6 )2071–2076.
  3. Richards, D.E., Peng, J. and Harberd, N.P. Plant GRAS and metazoan STATs: one family?[J]. Bioessays. 2000, 22: 573–577.
  4. Bolle, C. The role of GRAS proteins in plant signal transduction and Development[J]. Planta. 2004, 218: 683–692.
  5. Pysh, L.D., Wysocka-Diller, J.W., Camilleri, C., Bouchez, D.and Benfey, P.N. The GRAS gene family in Arabidopsis: sequence characterization and basic expression analysis of the SCARECROW-LIKE genes[J]. Plant J. 1999, 18: 111–119.
  6. ↑ K. Schumacher, T. Schmitt, M. Rossberg, G. Schmitz, K. Theres The Lateral suppressor (Ls) gene of tomato encodes a new member of the VHIID protein family[J]. PNAS. 1999, 96:290–295.
  7. Yonghong Wang and Jiayang Li. The plant architecture of rice (Oryza sativa)[J]. Plant Molecular Biology. 2005, 59:75–84.
  8. Gao Dong, Sun Hongwei, Liu Xueqing, He Xiahong, Wang Yunyue. et al. Establishment of Real-time TaqMan-Fluorescence Quantitative RT-PCR Assay for Detection of MOC1 mRNA Expression in Rice[J]. Molecular Plant Breeding. 2008, 6(6), 1197-1203.
  9. Greb T, Clarenz O, Schafer E, Muller D, Herrero R, Schmitz G, Theres K. Molecular analysis of the LATERAL SUPPRESSOR gene in Arabidopsis reveals a conserved control mechanism for axillary meristem formation[J]. Genes Dev. 2003, 17:1175-1187.
  10. Doebley, J., Stec, A. and Gustus, C. Teosinte branched1 and the origin of maize: evidence for epistasis and the evolution of dominance[J]. Genetics. 1995, 141: 333–346.
  11. Doebley J, Stec A, Hubbard L. The evolution of apical dominance in maize[J]. Nature 1997, 386:485-488.
  12. 12.0 12.1 Takeda T, Suwa Y, Suzuki M, Kitano M, Ueguchi-Tanaka M, Ashikari M, Matsuoka M, Ueguchi C. The OsTB1 gene negatively regulates lateral branching in rice[J]. Plant J 2003, 33:513-520.
  13. Arite T, Iwata H, Ohshima K, Maekawa M, Nakajima M, Kojima M, Sakakibara H, Kyozuka J. DWARF10, an RMS1/MAX4/DAD1 ortholog, controls lateral bud outgrowth in rice[J]. Plant J 2007, 51:1019-1029.

Structured Information

Gene Name

Os06g0610300

Description

Conserved hypothetical protein

Version

NM_001064587.1 GI:115468905 GeneID:4341506

Length

626 bp

Definition

Oryza sativa Japonica Group Os06g0610300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:25189473..25190098

Sequence Coding Region

25189730..25189909

Expression

GEO Profiles:Os06g0610300

Genome Context

<gbrowseImage1> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:25189473..25190098 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtag</cdnaseq>

Protein Sequence

<aaseq>MQCETLTQLDQVWGVCLFLLQGSYLEAIINEDPTKGQNMRWLET WVCLVSIQPFKALRV</aaseq>

Gene Sequence

<dnaseqindica>258..437#attcactcatgagttaaaattttactcggagttaaattttaactcatgatgacgtaaacgaatctcggacgtccatttctcgatccaatggtagttttcaagttttcactacatatgtggtttgtactgtatattttcccttgcatctccatgtatctcaaaagttacatgagtggcacttgctactgtgcatgtagtatgtgtagcagctaggttataaatttctttatgtgtaacatgtgtgtgatgcatagtatatgcaatgtgaaacactgacacagctagaccaggtgtggggggtgtgcttgttcttgttgcaaggaagttatctggaggccatcatcaatgaagatcccaccaagggacaaaacatgagatggttggagacttgggtctgtctagtctctattcaaccatttaaagcattgcgtgtgtaggctacactcggagagagaacacagagcagccgtccaaaccgtctgaaatgataacttactctaagctagtaggagtgctagtagtaccctctatatgtgcaattttattcgttaaaaaggtttccatgcatgcttttttagtttatcaatagcctaaaccttttgaattattaagagttaattagtccc</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0610300, RefSeq:Os06g0610300