Os03g0706500

From RiceWiki
Revision as of 08:16, 13 May 2014 by Niexx (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

The structure of the chromosomal region encompassing the OsTB1 gene(from reference [1]).
Model of the OsMADS57-and OsTB1-mediated network for control of tillering(from reference [2]).

The rice TB1 gene (OsTB1) was first identified based on its sequence similarity with maize TEOSINTE BRANCHED 1 (TB1) which is involved in lateral branching in maize. Both genes encode putative transcription factors carrying a basic helix-loop-helix type of DNA-binding motif, named the TCP domain[1]. The deduced amino acid sequence of the OsTB1 ORF comprises 388 amino acid residues that is a member of the TCP family of transcription factors[3]. Note that the in-frame stop codon was found two codons upstream of the deduced first methionine, suggesting that the methionine is used as an initiation codon. The DNA fragment also contains 1261-and 1198-bp 5 'and 3'-non-coding regions, respectively. The OsTB1 protein contains three significant sequence motifs, the SP, TCP and R domains. The R domain contains basic amino acid residues and is conserved in subpopulations of the TCP family. The SP domain contains a number of serine and proline residues, and is found in a limited number of members whose primary structures entirely match that of TB1. Although the precise molecular functions of these domains except for the TCP domain remain unknown, the close resemblance of the primary structures of OsTB1 and maize TB1 together with the entire sequences strongly suggests that the biological function of OsTB1 is similar to that of maize TB1. A series of genetic and reverse-genetic analyses thus conducted indicated that OsTB1 is a negative regulator for lateral branching in rice[2][3][1].

The OsMADS57 protein negatively regulates the expression of D14 functioning in strigolactone(SL) signalling to control tillering. This negative regulation by OsMADS57 is suppressed by interaction with OsTB1, leading to the balanced expression of D14 for tillering[2].

Expression

Gross morphology of a rice plant overproducing OsTB1(a) and a control one with an empty vector (from reference [1]).

The expression of OsTB1 was detected in vegetative apical meristems, young roots and tillers of rice, and it seemed that there was weak expression in developed spikelets, but no expression in young leaves. The expression of OsTB1in tillers was stronger than in other tissues[4].

The total number of tillers is significantly reduced by the overexpression of OsTB1, but increased in an fc1 mutant containing a loss-of-function mutation of OsTB1. This strongly suggests that OsTB1 functions as a negative regulator for lateral branching in rice[3][1].An fc1 mutant strain, M56, exhibited a bushy morphology as to enhanced lateral branching. Quantitative analysis showed that the fc1 mutant generated a threefold higher number of tillers than the wild-type strain did.Sequencing analysis of the PCR amplified OsTB1 ORF from the fc1 genome revealed one nucleotide deletion in OsTB1. The C-base at the 327th nucleotide in the ORF was deleted in the fc1 mutant, resulting in a frame shift of the ORF generating a stop codon just downstream of the mutation[1].

Evolution

The OsTB1 shows 70%, 41%, 32% and 31% similarity with TB1, CYC, PCF1 and PCF2, respectively. The conserved TCP region of OsTB1 has 93%, 80%,49% and 46% similarity with TB1, CYC,PCF1 and PCF2,respectively. Moreover , the R conserved regions among TB1,CYC, OsTB1 are nearly identical[4].


Knowledge Extension

Strigolactones (SLs) are a group of newly identified plant hormones that control plant shoot branching[5]. SL signaling requires the hormone-dependent interaction of DWARF14 (D14) which is regulated by the interaction of OsMADS57 with OsTB1[2].

Labs working on this gene

  • National Laboratory of Plant Molecular Genetics,Institute of Plant Physiology and Ecology,Chinese Academy of Sciences, China
  • The Key Laboratory of Plant Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, China
  • Graduate School of Agriculture and Life Sciences, University of Tokyo, Tokyo 113-8657 ,Japan
  • Bioscience Center, Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan

References

<references> [2]

Structured Information

Gene Name

Os03g0706500

Description

TCP transcription factor family protein

Version

NM_001057563.1 GI:115454854 GeneID:4333856

Length

1935 bp

Definition

Oryza sativa Japonica Group Os03g0706500, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:29188933..29190867

Sequence Coding Region

29189438..29190604

Expression

GEO Profiles:Os03g0706500

Genome Context

<gbrowseImage1> name=NC_008396:29188933..29190867 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:29188933..29190867 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcttcctttcttcgattccccaagccccatggacataccgctttaccaacagcttcagctcacccctccctctccaaagcccgaccaccaccaccaccaccattccaccttcttctactaccaccaccacccacctccctccccttccttcccctccttcccctcccccgccgccgccacgatcgcctcgccgtcgccggccatgcaccccttcatggacttggagttggagccgcatgggcagcagctggcggcggcggaggaggacggggcaggcgggcaaggcgtcgacgccggggtgcccttcggcgtcgacggagcggcggcggccgcggcggcgaggaaggaccggcacagcaagataagcaccgccggcgggatgagggaccggcggatgcggctgtccctcgacgtcgcccgcaagttcttcgcgctccaggacatgctcggcttcgacaaggccagcaagacggtgcaatggctcctcaacatgtccaaggccgccatccgggagatcatgagcgacgacgcctcctccgtctgcgaggaggacggctccagcagcctctccgtcgacggcaagcagcagcagcacagcaacccggcggatcggggcggcggcgccggggaccacaagggcgccgctcacggccacagcgacgggaagaagccggccaagccgagaagggcagcggccaacccgaagccaccgcggcggctggccaatgcgcaccccgtccccgacaaggagtcgcgcgccaaggcgagggagcgggcgcgggagcggaccaaggagaagaaccggatgcggtgggtcaccctcgcctcggcaatcagcgtcgaggcggccaccgcggcggcggccgcgggggaggacaagtcgccgacgagccccagcaacaacctgaaccactcatcgtccaccaatcttgtgagcaccgaattggaggacggctcctcgtcaacgcgccacaacggcgtcggcgtcagcggcggccggatgcaagaaatctcggcggctagcgaggcgagcgacgtgatcatggcgttcgccaacggcggcgcgtacggcgacagcggcagctactacctgcagcagcagcatcagcaggatcagtgggagctcggcggcgtcgtctacgccaattcgcggcactactgctga</cdnaseq>

Protein Sequence

<aaseq>MLPFFDSPSPMDIPLYQQLQLTPPSPKPDHHHHHHSTFFYYHHH PPPSPSFPSFPSPAAATIASPSPAMHPFMDLELEPHGQQLAAAEEDGAGGQGVDAGVP FGVDGAAAAAAARKDRHSKISTAGGMRDRRMRLSLDVARKFFALQDMLGFDKASKTVQ WLLNMSKAAIREIMSDDASSVCEEDGSSSLSVDGKQQQHSNPADRGGGAGDHKGAAHG HSDGKKPAKPRRAAANPKPPRRLANAHPVPDKESRAKARERARERTKEKNRMRWVTLA SAISVEAATAAAAAGEDKSPTSPSNNLNHSSSTNLVSTELEDGSSSTRHNGVGVSGGR MQEISAASEASDVIMAFANGGAYGDSGSYYLQQQHQQDQWELGGVVYANSRHYC</aaseq>

Gene Sequence

<dnaseqindica>506..1672#aagatggcaacaccctgatctctagcttagctgcagaggggagaggaacctcacatccaaactcctagctacaacttgtactagcatcctaagcaaccaagcacaaccaaagcaagcaagcacgaacaattctttcttcctctctacctctagctgctgcctgcctcctaatcctcctacccaccactccacatgagcccatgctgtgtgcctgtgtctgtgtgtgtgttctactcctaccatgagagaagagaccaagcatcaaccaagctagctagctcgtcctctcctcgatctctacttctctctcccacacaagctgagcgcccaggtaggctgcctgctaggtctcgtgcatggccggacacatctgatcatagcccactacggcactattccccccttccgcctcgcacgctgagaggtggccggagagggagggaggccagcgagcagcagtagcagcagcaacgcggctaggagtaaggagtcccatcagtaaagcatgcttcctttcttcgattccccaagccccatggacataccgctttaccaacagcttcagctcacccctccctctccaaagcccgaccaccaccaccaccaccattccaccttcttctactaccaccaccacccacctccctccccttccttcccctccttcccctcccccgccgccgccacgatcgcctcgccgtcgccggccatgcaccccttcatggacttggagttggagccgcatgggcagcagctggcggcggcggaggaggacggggcaggcgggcaaggcgtcgacgccggggtgcccttcggcgtcgacggagcggcggcggccgcggcggcgaggaaggaccggcacagcaagataagcaccgccggcgggatgagggaccggcggatgcggctgtccctcgacgtcgcccgcaagttcttcgcgctccaggacatgctcggcttcgacaaggccagcaagacggtgcaatggctcctcaacatgtccaaggccgccatccgggagatcatgagcgacgacgcctcctccgtctgcgaggaggacggctccagcagcctctccgtcgacggcaagcagcagcagcacagcaacccggcggatcggggcggcggcgccggggaccacaagggcgccgctcacggccacagcgacgggaagaagccggccaagccgagaagggcagcggccaacccgaagccaccgcggcggctggccaatgcgcaccccgtccccgacaaggagtcgcgcgccaaggcgagggagcgggcgcgggagcggaccaaggagaagaaccggatgcggtgggtcaccctcgcctcggcaatcagcgtcgaggcggccaccgcggcggcggccgcgggggaggacaagtcgccgacgagccccagcaacaacctgaaccactcatcgtccaccaatcttgtgagcaccgaattggaggacggctcctcgtcaacgcgccacaacggcgtcggcgtcagcggcggccggatgcaagaaatctcggcggctagcgaggcgagcgacgtgatcatggcgttcgccaacggcggcgcgtacggcgacagcggcagctactacctgcagcagcagcatcagcaggatcagtgggagctcggcggcgtcgtctacgccaattcgcggcactactgctgatgtgatcatccatccacacacgaacgaacgaacgaacggtacggcactaagatcgaactcctgcagctacataattatcctttgcttctcaagagtaataattcttgacgtgttaattaatccgggtgtgtattaattccctctttattattttttctcgcgtttatccggagttgactgtggtgaagacgaactttggtttggtcatcgcatggtgtgcattgcatatatagctagcactatcgtctgatcgatgattcatc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0706500, RefSeq:Os03g0706500

  1. 1.0 1.1 1.2 1.3 1.4 1.5 Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  2. 2.0 2.1 2.2 2.3 2.4 Sasaki A, Ashikari M, Ueguchi-Tanaka M, Itoh H, Nishimura A, et al. (2002) Green revolution: a mutant gibberellin-synthesis gene in rice. Nature 416: 701-702.
  3. 3.0 3.1 3.2 Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. 4.0 4.1 Cite error: Invalid <ref> tag; no text was provided for refs named .E6.B0.B4.E7.A8.BBOsTB1.E5.9F.BA.E5.9B.A0.E7.9A.84.E7.BB.93.E6.9E.84.E5.8F.8A.E5.85.B6.E8.A1.A8.E8.BE.BE.E5.88.86.E6.9E.90-2
  5. Cite error: Invalid <ref> tag; no text was provided for refs named .E6.9D.8E.E5.AE.B6.E6.B4.8Bnature12870