Os08g0509600

From RiceWiki
Revision as of 03:07, 15 May 2014 by Wangmin2013 (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

The rice gene OsSPL14 plays an important role in controlling rice plant architecture as well as yield. OsSPL14 encodes a SQUAMOSA promoter-binding-like (SPL) protein, as a gene that can affect plant architecture[1].
Figure 1. OsSPL14 regulates plant morphology and influences rice grain yield(from reference)[1].
Figure 1 shows that OsSPL14 regulates plant morphology and influences rice grain yield. (a) Classic rice plants are highly tillered with relatively small panicles. (b) In contrast, the new plant type (NPT) architecture is characterized by fewer tillers and more productive panicles. Normally, OsmiR156 induces cleavage of OsSPL14 transcripts, leading to a repression of OsSPL14 activity. However, mutation of an OsmiR156 binding site within OsSPL14 increases the levels of OsSPL14 and results in rice plants with fewer tillers but more productive panicles and consequently higher grain yields[1].

Higher expression of OsSPL14 in the reproductive stage promotes panicle branching and higher grain yield in rice. OsSPL14 controls shoot branching in the vegetative stage and is affected by microRNA excision[2].

Mutation

Jiao et al. demonstrate that a point mutation in OsSPL14 perturbs OsmiR156-directed regulation of OsSPL14, generating an‘ideal’ rice plant with a reduced tiller number, increased lodging resistance and enhanced grain yield[3].

Expression

Luo et al. confirm that OsSPL14 is expressed in the leaf primordia but is excluded from the meristematic cells[4].

Figure 1. Expression pattern of OsSPL14(from reference)[4].

Evolution

SPL protein are plant-specific transcription factors containing a highly conserved DNA-binding domain called an SBP-box. The founder members of the SPL family, SBP1 and SBP2, were identified in Antirrhinum majus as proteins that bind to a sequence motif present in the promoter of SQUAMOSA (SQUA), the MADS-box gene which specifies flower meristem identity. SPL genes are widely conserved in both dicots and monocots. In maize, a few SPL genes have been identified, including liguleless1 (LG1), teosinte glume architecture 1 (tga1) and tasselsheath4 (TSH4)[4].

The rice OsSPL14 gene is the closest homolog of the Arabidopsis SPL9 and SPL15 genes and one of the 11 OsmiR156-targeted SPL genes of rice[4].

Knowledge Extension

The SPL genes make up a plant-specific multigene family of transcription factors that can play roles in regulating plant morphology and the decision to flower[1].

Labs working on this gene

  • State Key Laboratory of Plant Genomics and National Center for Plant Gene Research, Institute of Genetics and Developmental Biology, Chinese Academy of Sciences, Beijing 100101, China
  • Graduate School of Agriculture and Life Sciences, University of Tokyo, Yayoi, Bunkyo, Tokyo 113-8657, Japan
  • Department of Bioscience, Fukui Prefectural University, 4-1-1 Matsuoka Kenjyojima, Eiheiji-cho, Yoshida-gun, Fukui 910-1195, Japan
  • Bioscience and Biotechnology Center, Nagoya University, Nagoya, Aichi 464-8601, Japan

References

  1. 1.0 1.1 1.2 1.3 Springer N. Shaping a better rice plant[J]. Nat Genet, 2010,42(6):475-476.
  2. Miura K, Ikeda M, Matsubara A, Song X-J, Ito M, Asano K, et al. OsSPL14 promotes panicle branching and higher grain productivity in rice[J]. Nat Genet, 2010,42(6):545-549.
  3. Jiao Y, Wang Y, Xue D, Wang J, Yan M, Liu G, et al. Regulation of OsSPL14 by OsmiR156 defines ideal plant architecture in rice[J]. Nat Genet, 2010,42(6):541-544.
  4. 4.0 4.1 4.2 4.3 Luo L, Li W, Miura K, Ashikari M, Kyozuka J. Control of tiller growth of rice by OsSPL14 and Strigolactones, which work in two independent pathways[J]. Plant & cell physiology, 2012,53(10):1793-1801.

Structured Information

Gene Name

Os08g0509600

Description

Similar to Squamosa-promoter binding-like protein 8

Version

NM_001068739.1 GI:115477215 GeneID:4345998

Length

4156 bp

Definition

Oryza sativa Japonica Group Os08g0509600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:25362546..25366701

Sequence Coding Region

25362793..25363463,25363566..25363699,25366130..25366578

Expression

GEO Profiles:Os08g0509600

Genome Context

<gbrowseImage1> name=NC_008401:25362546..25366701 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:25362546..25366701 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagatggccagtggaggaggcgccgccgccgccgccggcggcggagtaggcggcagcggcggcggtggtggtggaggggacgagcaccgccagctgcacggtctcaagttcggcaagaagatctacttcgaggacgccgccgcggcagcaggcggcggcggcactggcagtggcagtggcagcgcgagcgccgcgccgccgtcctcgtcttccaaggcggcgggtggtggacgcggcggagggggcaagaacaaggggaagggcgtggccgcggcggcgccaccgccgccgccgccgccgccgcggtgccaggtggaggggtgcggcgcggatctgagcgggatcaagaactactactgccgccacaaggtgtgcttcatgcattccaaggctccccgcgtcgtcgtcgccggcctcgagcagcgcttctgccagcagtgcagcaggttccacctgctgcctgaatttgaccaaggaaaacgcagctgccgcagacgccttgcaggtcataatgagcgccggaggaggccgcaaacccctttggcatcacgctacggtcgactagctgcatctgttggtgagcatcgcaggttcagaagctttacgttggatttctcctacccaagggttccaagcagcgtaaggaatgcatggccagcaattcaaccaggcgatcggatctccggtggtatccagtggcacaggaacgtagctcctcatggtcactctagtgcagtggcgggatatggtgccaacacatacagcggccaaggtagctcttcttcagggccaccggtgttcgctggcccaaatctccctccaggtggatgtctcgcaggggtcggtgccgccaccgactcgagctgtgctctctctcttctgtcaacccagccatgggatactactacccacagtgccgctgccagccacaaccaggctgcagccatgtccactaccaccagctttgatggcaatcctgtggcaccctccgccatggcgggtagctacatggcaccaagcccctggacaggttctcggggccatgagggtggtggtcggagcgtggcgcaccagctaccacatgaagtctcacttgatgaggtgcaccctggtcctagccatcatgcccacttctccggtgagcttgagcttgctctgcaggggaacggtccagccccagcaccacgcatcgatcctgggtccggcagcaccttcgaccaaaccagcaacacgatggattggtctctgtag</cdnaseq>

Protein Sequence

<aaseq>MEMASGGGAAAAAGGGVGGSGGGGGGGDEHRQLHGLKFGKKIYF EDAAAAAGGGGTGSGSGSASAAPPSSSSKAAGGGRGGGGKNKGKGVAAAAPPPPPPPP RCQVEGCGADLSGIKNYYCRHKVCFMHSKAPRVVVAGLEQRFCQQCSRFHLLPEFDQG KRSCRRRLAGHNERRRRPQTPLASRYGRLAASVGEHRRFRSFTLDFSYPRVPSSVRNA WPAIQPGDRISGGIQWHRNVAPHGHSSAVAGYGANTYSGQGSSSSGPPVFAGPNLPPG GCLAGVGAATDSSCALSLLSTQPWDTTTHSAAASHNQAAAMSTTTSFDGNPVAPSAMA GSYMAPSPWTGSRGHEGGGRSVAHQLPHEVSLDEVHPGPSHHAHFSGELELALQGNGP APAPRIDPGSGSTFDQTSNTMDWSL</aaseq>

Gene Sequence

<dnaseqindica>3239..3909#3003..3136#124..572#ttccgtctctttcctctctcttctctctccccctctcctggaggagagagaggagaagaggagggggggccgcgccaagagccacgcgcgctacagtctccttcccacccgcgaccgcgagcaatggagatggccagtggaggaggcgccgccgccgccgccggcggcggagtaggcggcagcggcggcggtggtggtggaggggacgagcaccgccagctgcacggtctcaagttcggcaagaagatctacttcgaggacgccgccgcggcagcaggcggcggcggcactggcagtggcagtggcagcgcgagcgccgcgccgccgtcctcgtcttccaaggcggcgggtggtggacgcggcggagggggcaagaacaaggggaagggcgtggccgcggcggcgccaccgccgccgccgccgccgccgcggtgccaggtggaggggtgcggcgcggatctgagcgggatcaagaactactactgccgccacaaggtgtgcttcatgcattccaaggctccccgcgtcgtcgtcgccggcctcgagcagcgcttctgccagcagtgcagcaggtcactctctcactcacctcgccattgctgatgtcaccactgcttttgctttgctttgcttgctctccctcctctttcacctatctctcttgtttatttgcttcttgttcttgtttagtgctagtacatgtgttgttattgttgtgccgttttgtcttttgggttattgtgttgttgttactactcgttttactataggtttttaaggtttatgagcacggccaccacattagatgcactgtcaagtggtgtgtgtgggacctttcctgctaaaacaagctgatttcaactctctgaaacttcctgcatttcatctatttttatctttgattgtgttgggagtactacactagtagtgttaatattttgactggtgcttatgagatttttaagttggtaggttgatgaggaaaatactcctttatatggttgagtgatgtgacttgcctgtctgcctgcctgcctgccgctttgcataagattcctctgtgttagtaagagccactgtttatttgtactggtgcttactctacttagttaattagccattagctataaaattccgttgatgttgcaagcttagcaatggccacggtaagaatgggagagagaagttggctaaagctgttgctttgtagtttgtactatatatgtgtctttgtgttgcaagatatgcaactcctactatgctgtgacttgagctcaaggttttcagttatctatagatccttactactactgagcatactaccacttctgtatggtagcatatggtagcatagtccaagttccaacgcctcgccagttgttcataatctatactaccacttctgtgcatttgttacttttatttaatagtttgtctcattagctgacaagcatatgcctgttttgatatctgcccctcttgtaatagtctatggatagcttggactgtttgatgctttaattttttactagcaacacttagggcccctttgaaatggaggattagcaaaggaattttggaggattcattttcctaaggattttttcctatagagccctttgattcatagaaagaggataggaaaacttccgtaggattgcattcctatgatcaattccataggaaaataagcaagaggttagacctcttgtgaaactttcctttgttgagtgtatcttgtggtataatcaaagggctcttctctccatttcatgtgttttcaattcctgtaggattggaaaaacatacaacttcaattcctacgtttttcctattcctatgtttttcctatcctgcgtttcaaaggggcccttaaggatgaagggaagtaagagaaacatactagagaatatgtagtagtatttctacattccatatttgtagcactagcccacaaatatctttgccttgtacttacttcataccagttccccccttttcagagcaaaccaacaatttctgttgccttatatatctagtgtcttcgtactaatatatctgttccaaaatgtacctgtccaaattcatagctagaaatagctttatttaggacggaagtaataactgttgttagagacttggttcagacttttggttatgttgaggctactatcatttcctttacgggccaaattactacaaatgagaattcataaaaatgtcaagattttatgattgttgtagctttatttaggacggaggtagtaattgttgttagagacttggttcagacttttggttacgttgaagctactatcatttcctttatggtcaaattactaacaatgagtattcataaaaatgtcaagattttataattgagctgtgccagtgctaagtgtgtcactatctgatgccataatgcatcattataaaagccagatggaccattagcttttatgtgtaggacacctgccgtccaattagatggataaccatctagtgtttgtgtactgttattttaagcccgacatctcacaactccatgaatgattacagtcttcctttcacatggtgtccttttgttgtgttaggaatagcattttttatttatgggtgtaattatgaaaggcactaggagagttgctgctttatcttgatgggatttgtagtaataccatctttaggatgacaagaaatcttgttctgagttagcatgggctgccttttgacctgagctacggtttgctatgtttggcttgcatcatgcagatctattaggataataagcatataaaagttgcttgcattgtgcattgcttgttttaccttgattcatgtaggagtaatttgctcgccatgcctcgttttgctttctgagtcaacagccaaatttagatgatgtaccttctgttgcttcaaaaactcagtcactgcacagcagcagtggataggattcagaatcaatctatccatgattctctgttcacataatatgacaggttccacctgctgcctgaatttgaccaaggaaaacgcagctgccgcagacgccttgcaggtcataatgagcgccggaggaggccgcaaacccctttggcatcacgctacggtcgactagctgcatctgttggtggtatcatcagaggctcttgttttctttgcatcttgtgtgtttgttggtaactactggttgcattcgctgatgtgttgtttgttgcgattcttgatccagaagagcatcgcaggttcagaagctttacgttggatttctcctacccaagggttccaagcagcgtaaggaatgcatggccagcaattcaaccaggcgatcggatctccggtggtatccagtggcacaggaacgtagctcctcatggtcactctagtgcagtggcgggatatggtgccaacacatacagcggccaaggtagctcttcttcagggccaccggtgttcgctggcccaaatctccctccaggtggatgtctcgcaggggtcggtgccgccaccgactcgagctgtgctctctctcttctgtcaacccagccatgggatactactacccacagtgccgctgccagccacaaccaggctgcagccatgtccactaccaccagctttgatggcaatcctgtggcaccctccgccatggcgggtagctacatggcaccaagcccctggacaggttctcggggccatgagggtggtggtcggagcgtggcgcaccagctaccacatgaagtctcacttgatgaggtgcaccctggtcctagccatcatgcccacttctccggtgagcttgagcttgctctgcaggggaacggtccagccccagcaccacgcatcgatcctgggtccggcagcaccttcgaccaaaccagcaacacgatggattggtctctgtagaggctgttccagctgccatcgatctgtcgtcccgcaaggcgagtcatggaactgaagaacctcatgctgcctgcccttattttgtgttcaaattttcctttccagtatggaaaggaaattctaaggtgactggcgattaatctccctgtgatgaataataatgcgcgcccttgaactcaattaattgctgtgccgcatccatctatgtaactctccatgaatttttaagtatcagtgttaatgctgt</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0509600, RefSeq:Os08g0509600