Os05g0586200

From RiceWiki
Revision as of 18:35, 18 May 2014 by Shixing (talk | contribs) (Annotated Information)
Jump to: navigation, search

Please input one-sentence summary here.

==Annotated Information haha

Annotated Information

Function

Figure1:Gene expression and hormone content in wild type and OsJAR1 TOS17 insertion lines after simulated herbivory (WOS)(frome reference[1]).
Figure2:The expression levels of OsJAR1 and OsJAR2 mRNA and the accumulation of JA and JA-amino acid conjugates in response to wounding(from reference[2]).

OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice by the use of an osjar1 Tos17 mutant.[1][3]It is involved in phytochrome and jasmonate signalling. In far-red and blue lights, osjar1 coleoptiles were longer if compared with the wild type (WT), indicating that OsJar1participates in the suppression of coleoptile elongation in these light conditions, while the mutant did not show a clear phenotype in red light.OsJar1 modulates light and JA signalling in the photomorphogenesis of rice.[4] Light can induce jasmonate-isoleucine conjugation via OsJAR1-dependent pathways in rice. OsJAR1 is the most important JA-Ile conjugating enzyme in the wounding response during the vegetative stage.[5]Plants produce jasmonic acid (JA) and its amino acid conjugate, jasmonoyl‐L‐isoleucine (JA‐Ile) as major defense signals in response to wounding and herbivory. OsJAR1‐deficient plants have strongly reduced JA‐Ile levels after WOS[1].

Expression

(1)OsJar1 transcripts were up-regulated transiently in response to treatment with exogenous methyl-jasmonic acid (MeJA)[4].The expression levels of OsJAR1 and OsJAR2 were induced in response to wounding with the concomitant accumulation of JA-Ile.[2]

(2)Real-time PCR was conducted according to the QuantiTect SYBR Green PCR handbook (Qiagen). PCR was perfomed in ABI PRISM 7000 cycler (PE Applied Biosystems, Warrington, UK) using QuantiTect SYBR green-mastermix with HotStar Taq DNA polymerase following the recommended conditions [15 min 95 °C, 40× (15 s, 94 °C; 30 s, 60 °C; 30 s, 72 °C)]. JAR1F2 and JAR1R2 were used as primers to amplify OsJar1 cDNA, Rubg237F and Rubg304R for ubiquitin, which was used as the endogenous control gene.

For RT-PCR, first-strand cDNA synthesis kit for RT-PCR (Roche, Mannheim, Germany) was performed according to the manufacturer's description. A 1 µL aliquot of a 1:10 dilution of the RT product was used as a template in the subsequent PCR reaction. For amplification of OsJAR1 cDNA, the primers JAR1F1 and JAR1R2 were used, for ubiquitin Rubg237F and Rubg 304R. The PCR conditions were 1 min 94 °C, 30× (94 °C, 1 min; 60 °C, 1 min; 72 °C, 2 min), 72 °C, 7 min.[4]

Primers used in real-time PCR and RT-PCR:

JAR1F1: TAAGGCATTACGCAGGGAAC

JAR1F2: AGTGCTGAGCATCAACATCG

JAR1R1: CCAGATAACAGCACCAGAAGC

JAR1R2: CACCACCAAGGCTTAGGAAA

Rubg237F: GAGCCTCTGTTCGTCAAGTA

Rubg304R: ACTCGATGGTCCATTAAACC[4]


Evolution

OsJar1 belongs to the GH3 family in rice. Another member of this family in Arabidopsis, DWARF IN LIGHT 2 (DFL2), showed 47% identities. Dfl2 was shown to be a light-dependent gene, but its gene product did not show enzymatic activity on plant hormones, presumably (Takase et al. 2003). OsJAR1 contained three domains described to be important for the enzymatic function of GH3 proteins (Chang, Xiang & Dunaway-Mariano 1997; Staswick et al. 2002; Terol et al. 2006).[4]

You can also add sub-section(s) at will.

Labs working on this gene

  • Biotechnology Research Center, The University of Tokyo, Tokyo 113-8657, Japan.
  • Division of Applied Bioscience, Research Faculty of Agriculture, Hokkaido University, Sapporo 060-8589, Japan
  • National Agricultural Research Center of Hokkaido region, National Agriculture and Food Research Organization, Sapporo 062-8555, Japan
  • Botanical Institute, Karlsruhe Institute of Technology, 76131 Karlsruhe, Germany
  • Department of Biochemistry, Max Planck Institute for Chemical Ecology, 07745 Jena,Germany
  • Department of Plant Physiology, National Institute of Agrobiological Sciences, Tsukuba, Ibaraki 305-8602, Japan
  • RIKEN Plant Science Center, Tsurumi,Yokohama, Kanagawa 230-0045, Japan

References

  1. 1.0 1.1 1.2 Kaori Fukumoto, Kabir Md Alamgir, Yuko Yamashita, Ivan Galis, et al. (2013) Response of rice to insect elicitors and the role of OsJAR1 in wound and herbivory-induced JA-Ile accumulation[J]. Integr Plant Biol 55: 775–784.
  2. 2.0 2.1 Shinji Wakutaa, Erika Suzukia, Wataru Saburia,*, Hideyuki Matsuuraa, Kensuke Nabetaa, Ryozo Imaib and Hirokazu Matsuia (2011) OsJAR1 and OsJAR2 are jasmonyl-L-isoleucine synthases involved in wound- and pathogen-induced jasmonic acid signaling[J].Biochemical and Biophysical Research Communications,409(4): 634-639.
  3. Shimizu T, Miyamoto K, Miyamoto K, Minami E, Nishizawa Y, Iino M, Nojiri H, Yamane H, Okada K. (2013) OsJAR1 contributes mainly to biosynthesis of the stress-induced jasmonoyl-isoleucine involved in defense responses in rice[J].Bioscience, Biotechnology, and Biochemistry 77(7):1556-1564.
  4. 4.0 4.1 4.2 4.3 4.4 MAREN RIEMANN, MICHAEL RIEMANN and MAKOTO TAKANO. (2008) Rice JASMONATE RESISTANT 1 is involved in phytochrome and jasmonate signalling. Plant, Cell & Environment 31(6):783–792.
  5. KATHARINA SVYATYNA, YUSUKE JIKUMARU, RITA BRENDEL, MICHAEL REICHELT, AXEL MITHÖFER, MAKOTO TAKANO, YUJI KAMIYA, PETER NICK & MICHAEL RIEMANN. (2013) Light induces jasmonate-isoleucine conjugation via OsJAR1-dependent and -independent pathways in rice.Plant, Cell & Environment 37(4):827-839.

Structured Information

Gene Name

Os05g0586200

Description

GH3 auxin-responsive promoter family protein

Version

NM_001062995.1 GI:115465720 GeneID:4339756

Length

5516 bp

Definition

Oryza sativa Japonica Group Os05g0586200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:29281780..29287295

Sequence Coding Region

29284407..29284687,29284793..29284894,29285094..29285911,29286499..29287043

Expression

GEO Profiles:Os05g0586200

Genome Context

<gbrowseImage1> name=NC_008398:29281780..29287295 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:29281780..29287295 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacgatctgcagctgtgaggagacgatcaatgagtttgagatgttaacgcgtgatgctgcgcgtgtgcagaaggatacactgaaaaagatccttgagataaatgctagtgctgagtacctgcagaactttgggcttggggggaggactgatgccgagagctacaaatcctgcatcccattgtgtgtgcacaatgatattgagccctatatccagcggattgttgatggcgatacctcaccagtggtcactggagaacccatcaccaacctctctctcagttccggtacaacacacggaaagcccaagttcattccattcaatgatgaattacttgagaccacacttcaaatataccgtacatcttacgcgtttaggaaccgtgaataccctattggccaaggaaaagcactgcagtttgtttatggtagcaagcaagtcataacgaaaggtggcattcttgcaacaactgcgacaacaaacttgtataggagacagcgctataaggaaggcatgaaggatatccagtcgcagtgttgcagtcctgatgaagttatctttggccctgatttccaccaatccttgtactgtcacttgctgtgtgggttaatatactcagaggaggtccattcagtgttctcaacatttgctcacagcctagtccatgcattccaaacattcgaggaggtttgggaagatctatgcactgatataagagacggtgttctctcaaagaaagttacagcaccatcaattcgtgaggctgtttcaaaaatcctgaagcccaatcctgaacttgctgactcaatatacaagaagtgtattggtttgagcaattggtatggagtgatcccagcactgtggccaaatgcaaagtatgtgtatggtatcatgacaggatccatggagccatatctgaaaaaattaaggcattacgcagggaacttgccacttataagtgctgactatggcgcatcggaaggatgggttggctctaacatagaccctactgtgccaccagagcaggtgacatatgctgttctcccacaagttggttattttgagttcattcctttggagaaaccaataggggaggagacagaaaactccgcctccattcattacatagaatcagatccagttggcttgactgaagttgaggtcggcaaaatctatgaagttgtaataactaactttgcaggtctatatcggtacaggctaggagatgtcgtgaagatagcacgcttccacaactccacacctgagctccaattcatctgtcgcagaagcctagtgctgagcatcaacatcgacaagaacaccgagaaagacctccagttggctgttgaggaggcatcaaagttcctggaaggagagaagctcgaagtcatggatttcacgagcttcgtggaacgatcaagcgatccagggcgctacgtgatcttctgggagctgagtggcgatgcgagtgatgaggtcttgagcagctgcgcaaatgccttggatctagccttcattgacgcaggctacacgggctcgaggaagatcaagacgatcggcccccttgagctccggatcctcagaaagggaaccttcaaggagatcctagatcatttcctaagccttggtggtgcggtgagccagttcaagacaccaaggtttgtgaacccatcaaacagcaaggtgttgcagatactgagtagaaatgtcacccaaagttatttcagtactgcctatggattttga</cdnaseq>

Protein Sequence

<aaseq>MTICSCEETINEFEMLTRDAARVQKDTLKKILEINASAEYLQNF GLGGRTDAESYKSCIPLCVHNDIEPYIQRIVDGDTSPVVTGEPITNLSLSSGTTHGKP KFIPFNDELLETTLQIYRTSYAFRNREYPIGQGKALQFVYGSKQVITKGGILATTATT NLYRRQRYKEGMKDIQSQCCSPDEVIFGPDFHQSLYCHLLCGLIYSEEVHSVFSTFAH SLVHAFQTFEEVWEDLCTDIRDGVLSKKVTAPSIREAVSKILKPNPELADSIYKKCIG LSNWYGVIPALWPNAKYVYGIMTGSMEPYLKKLRHYAGNLPLISADYGASEGWVGSNI DPTVPPEQVTYAVLPQVGYFEFIPLEKPIGEETENSASIHYIESDPVGLTEVEVGKIY EVVITNFAGLYRYRLGDVVKIARFHNSTPELQFICRRSLVLSINIDKNTEKDLQLAVE EASKFLEGEKLEVMDFTSFVERSSDPGRYVIFWELSGDASDEVLSSCANALDLAFIDA GYTGSRKIKTIGPLELRILRKGTFKEILDHFLSLGGAVSQFKTPRFVNPSNSKVLQIL SRNVTQSYFSTAYGF</aaseq>

Gene Sequence

<dnaseqindica>2628..2908#3014..3115#3315..4132#4720..5264#acccgctctctcctctcatctcctcctcctgtgttcgtgttcttcttcttcttgtagcagcgcttaaccaacccatcattagcgaccaaacctctctccctctccccctctgactaatcaaaattaaacaatttcgatctccaccttcctcttcttgattccagttccaccagagagagacagggtcttctctaatccatgtggtgcttgttggtctcgcttgcttcgtcttcgtcttcgtcttcctcttctcgcacctagtcccgcctcgtcgcctcctccggagaccggagccggacgggacggttgccggcgagcggcggtcgctttcttctctcggccctactcacggtcagtgattggctcccttccttcctggtgttctattgatcctttgtgggggaaaaaaggcttcgatttggggggcatgttcttgcctttttcctgttttgggggagacgagacggatttcaatatatttttttaatctggggggattatgtgtggaaaagattgttcctcgtttatctgggtagtatttggagggtcctatggggatattctttgtaaagctgggatttttaggtggtaaaataatgttgatatactttcagaaagaatatactgcagaaagtttttcagagataacagataagattaggccgtccttaatctcctttctttgcgtctgttccctccaactaggatggaaaagaatggcggattgattagtcagaaactggctgctgaatactctgagatttcatttcatttcagcctctgttgattcctcatggctgtctctaacttctttgcttgtgcttccgatttctttggcggtaaatagcctccacgaatctctggtcaacgaggtattaaaacttaaaagggcttttgtctcaggttgacccgagccatgattcgcccccctcccatgctttgcaaacaagatatgatacgcagtgctggtacaattcagagcatatgttctttcctcttttgctttgtttcagacagcaacttttagcagccacgcctctcacaagttgataaaaaaaaattttgtgttgctctcctactactcatcactttctagtgcgatatagtagtagtagtagtaggagtatatgctagcactatccacagtttagcacacagattggtggcacctgggcagatataaaagcttcacatttttatcaatgtctgcgcagttatattgtcgatttgattccttttatagatattactaggtcaagtcgtgtcgcaattactccccccctttcctccattgtagggtgttcctgtttagtccgcgggggatgctgctccctgagcctgtgtgtgtctcttgatttttctttctttgctcgcacgcagcagcagcagcatgttttgtgtcggtgttaaggaccctacataaataattcatcaaatcaagtatcttttgtctgttttggggaatctcctttgcggttcgtccaaaatttcgcgaaagaaacaattctatatgactgcttttgtcgagaggttagacatcactgctagagtagtagagcaatgctacacgtactaaatttttcttactaaacttttactaataatcatctcaaccgtttgatttaagtagatggaatttacaaaaaatctagatgcactcgtagcatgacacatcagtgttagtaagaatttagtaagaaaaagttagtacgtatagccttttccagagtagtactagcagagtgttagattgtatcacctgctcgggcagttgtaaatggtatggtgagttggtgactggtttttacagttttttcatacttgggtttatggaggatttactgttatggagacctgtaaaaaatgttacatatattgctactttctcatttggatttcggatggctgttttttttatcattatgttggtaaagttttgcatcaagaatctgaaccagcttagcaatactaatagtagatggttcagtaagctgcttccatgtccttgcaactttgcaatgctggcaattttttttcgaaaaagagcaaggctggcaatatgtgtatagcttttgtttggcaatatatgttgcgattctagcgctggtggtatctcaagatcagaaaaagtgagcatcaatgtcttactttattggttttctgactgattacattagtaaacgctgtgtccaaaagtatagagtaatactagttatattttcttaattgtcagtgactcagtatccgcagatggtttgtaaagtgcccttatttttcatggtcgttagctttagtaggtatatagtgtactcttgatggtttatcctttttttcgcccctttctcctttgtcatctgggcgcacgttgctatgcagtttcatgagatggttagtgcgtatccaactattctgtcggcaataaagttccacaatcttcaaaattttctaccattctgatgccaactcctactgcactatcagctcttggtttccagctcagttagtggttagaaattgcagcctacatgaaaaagtaactaatagattttctcgtctccaccttttatagttattttcagtgactcttcttccaaaccaagtggtaaagccaggattctaccattacaatgacgatctgcagctgtgaggagacgatcaatgagtttgagatgttaacgcgtgatgctgcgcgtgtgcagaaggatacactgaaaaagatccttgagataaatgctagtgctgagtacctgcagaactttgggcttggggggaggactgatgccgagagctacaaatcctgcatcccattgtgtgtgcacaatgatattgagccctatatccagcggattgttgatggcgatacctcaccagtggtcactggagaacccatcaccaacctctctctcaggtactgtacccattgcttgaaatttgtcaccttattatgcttatcgtttactagtttatgataataaatgttcatagtctggcttcttctgtggctttcatacagttccggtacaacacacggaaagcccaagttcattccattcaatgatgaattacttgagaccacacttcaaatataccgtacatcttacgcgtttaggaaccggtaaggatctctgatttattattatttatgctcaagtaatgctgctttttctgaatgttcaacaaactttgatgatcaggttcaacatgagttattgtttttatacactgttttgcatgctattaacttgttgcttctttgtgtattttttactctgcatcccagaatattagaataaccttctgttttgtgtttacagtgaataccctattggccaaggaaaagcactgcagtttgtttatggtagcaagcaagtcataacgaaaggtggcattcttgcaacaactgcgacaacaaacttgtataggagacagcgctataaggaaggcatgaaggatatccagtcgcagtgttgcagtcctgatgaagttatctttggccctgatttccaccaatccttgtactgtcacttgctgtgtgggttaatatactcagaggaggtccattcagtgttctcaacatttgctcacagcctagtccatgcattccaaacattcgaggaggtttgggaagatctatgcactgatataagagacggtgttctctcaaagaaagttacagcaccatcaattcgtgaggctgtttcaaaaatcctgaagcccaatcctgaacttgctgactcaatatacaagaagtgtattggtttgagcaattggtatggagtgatcccagcactgtggccaaatgcaaagtatgtgtatggtatcatgacaggatccatggagccatatctgaaaaaattaaggcattacgcagggaacttgccacttataagtgctgactatggcgcatcggaaggatgggttggctctaacatagaccctactgtgccaccagagcaggtgacatatgctgttctcccacaagttggttattttgagttcattcctttggagaaaccaataggggaggagacagaaaactccgcctccattcattacatagaatcagatccagttggcttgactgaagttgaggtcggcaaaatctatgaagttgtaataactaactttgcaggtatattctctcttttctatctattctgaatcttaaattgggttaaatctccattatctagaagtatagcaatgaaaattctacaaaaagcaaggggcagccatccctagttctgcttctggtgctgttatctggtcagacatgataccaacgggatttatcagaaataactagataagtttgtgtgacatattatttcaaaaaagaaatatttattagtcttgccccttcaatcttaaacctctttttgacaagagctccttattatgtaaaaaacataaaaatcacacggttgcaatgtatacatcaatattattaagcacatgggggagtaattattgtgaatgtttgtggtccactccttgaactctttgctgcttactcattatgattatcttaaaactctatcagatgatatatgtttctttttgtgtatgccaaccatgccagactcaccaataacatttttattctttaatatctctggctaacatacaattattttgttttaggacacagaaagtttacttattacggtgatgtttaagaaacactaaaatctttttcttttttctattttgttctaggtctatatcggtacaggctaggagatgtcgtgaagatagcacgcttccacaactccacacctgagctccaattcatctgtcgcagaagcctagtgctgagcatcaacatcgacaagaacaccgagaaagacctccagttggctgttgaggaggcatcaaagttcctggaaggagagaagctcgaagtcatggatttcacgagcttcgtggaacgatcaagcgatccagggcgctacgtgatcttctgggagctgagtggcgatgcgagtgatgaggtcttgagcagctgcgcaaatgccttggatctagccttcattgacgcaggctacacgggctcgaggaagatcaagacgatcggcccccttgagctccggatcctcagaaagggaaccttcaaggagatcctagatcatttcctaagccttggtggtgcggtgagccagttcaagacaccaaggtttgtgaacccatcaaacagcaaggtgttgcagatactgagtagaaatgtcacccaaagttatttcagtactgcctatggattttgatacaaagaaacatattagatgctagcagctgcatgtaattacctttttacctcttgtttttcagctttactgtagtctccaccggaagaaaacgtttggtttagtctcttgaataatctattttcttatcctgtttgtgactatctagaatctatgtaaatggcccagctctagtgaaagttatggtgatgttatcaggaaagaaaatgtggtgtttcccgtaacaagtgctgcaaagtattattcagactc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0586200, RefSeq:Os05g0586200