Os02g0649900

From RiceWiki
Revision as of 10:04, 19 May 2014 by Eric Fu (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

OsYSL2 is an Fe-regulated metal-NA transporter that is involved in phloem transport and the translocation of mineral nutrients in grains[1]. The altered expression of OsYSL2changes the localization of Fe, and that OsYSL2 is a critical Fe-nicotianamine transporter important for Fe translocation,especially in the shoots and endosperm [2].Based on the nucleotide sequence,OsYSL2 was predicted to encode a polypeptide of 674 amino acids containing 14 putative transmembrane domains(figure 1a)[1]. Cells expressing the OsYSL2–GFP fusion protein showed a signal in the plasma membrane, with the presence of the putative transmembrane domains shows that OsYSL2 is a transporter that is localized in the plasma membrane(figure 1b)[1].

Expression

  • OsYSL2 was of particular interest because no detectable transcripts were present in the roots of either Fe-sufficient or Fe-deficient plants, but dramatic expression was induced in the leaves of Fe-deficient plants[1].Research by Yasuhiro Ishimaru et al. showed that the high expression of OsYSL2 in the roots under Fe deficiency was not consistent with previous study[2].
  • The cell-type specificity of OsYSL2 expression was investigated using promoter (1.5 kb):b-glucuronidase (GUS) analysis.GUS staining was observed in phloem cells of the vascular bundles of leaves and leaf sheaths of Fe-sufficient rice(Figure 3e–g). The phloem-specific expression of the OsYSL2 promoter suggested that OsYSL2 is involved in the phloem transport of Fe [1]. OsYSL2 is expressed during reproductive development in rice. RT-PCR analysis confirmed that OsYSL2 transcripts were increased during early seed development[1].
  • In fully mature seeds,strong OsYSL2 expression was observed in the epithelium, the vascular bundle of the scutellum, and the leaf primordium . Two days after sowing, the OsYSL2 expression level increased in the scutellum near the endosperm. Three days after sowing,OsYSL2 expression was observed in the bran and coleoptile[3].

Evolution

YS1-like genes in rice Our search for YS1homologues in the Oryza sativaL. Ssp. japonica (cv. Nipponbare) rice genomic database identified 18 putative OsYSL that exhibited 36–76% sequence similarity to YS1 (Figure 4)[1].

Labs working on this gene

  • Graduate School of Agricultural and Life Sciences, The University of Tokyo, 1-1-1 Yayoi, Bunkyo-ku, Tokyo 113-8657, Japan
  • Core Research for Evolutional Science and Technology (CREST), Japan Science and Technology Corporation, Kawaguchi 332-0012, Japan
  • National Agricultural Research Center, 1-2-1 Inada, Joetsu, Niigata 943-0193, Japan

References

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 Koike S, Inoue H, Mizuno D, et al. OsYSL2 is a rice metal‐nicotianamine transporter that is regulated by iron and expressed in the phloem[J]. The Plant Journal, 2004, 39(3): 415-424.PMID 15255870
  2. 2.0 2.1 Ishimaru Y, Masuda H, Bashir K, et al. Rice metal‐nicotianamine transporter, OsYSL2, is required for the long‐distance transport of iron and manganese[J]. The Plant Journal, 2010, 62(3): 379-390.PMID 20128878
  3. Nozoye T, Inoue H, Takahashi M, et al. The expression of iron homeostasis-related genes during rice germination[J]. Plant molecular biology, 2007, 64(1-2): 35-47.PMID 17333504

Structured Information

Gene Name

Os02g0649900

Description

Similar to Iron-phytosiderophore transporter protein yellow stripe 1

Version

NM_001054121.2 GI:297599682 GeneID:4330161

Length

3302 bp

Definition

Oryza sativa Japonica Group Os02g0649900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:27058478..27061779

Sequence Coding Region

27058478..27059406,27059491..27059605,27059697..27059886,27059990..27060124,27060204..27060301
,27061115..27061287,27061395..27061779

Expression

GEO Profiles:Os02g0649900

Genome Context

<gbrowseImage1> name=NC_008395:27058478..27061779 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:27058478..27061779 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaagccgccgctcccgagatagagaggtgcgacgccggcgacgtggagtcggaccacgacggcgccgccgccgccgccgagcgcgtgccgccgtggcgcgagcaggtgacggcgcggggcatggtggcggcgctgctcatcggattcgtctacaccgtcatcatcatgaagctggcgctcaccacggggatcatccccacgctcaacgtctccgccgcgctcctcgccttcctcgcgctccgcggctggacgcgcgcgcccgccctcctcctccccggcggcggcgccgcctcctcctcctcccggcgccgccccttcacccgccaggagaacaccgttgtccagacctgcgccgtcgcctgctacaccatgggattcggcggtgggttcgggtcgtcgctgctggctctgaacaggaagacgtacgagttggccggggtgagcacgccgggcaactcgccggggagctacaaggagcccggggtcgggtggatgaccggattcctgtttgcgattagcttcgttgggctccttaacttgcttccactcagaaaggctttgatcatagattataagttaacctatccaagtgggactgcaactgctgttcttataaacggattccatacccctcaaggagaaaatagtgcaaagaagcaagtccgcggatttctgaattgctttgggatcagcctcttatggagcttcttccagtggttctacactggtggagagagttgtgggtttcttcaattccctacctttggtctaaaggcttggaaacaaacgttctattttgatttcagcctcacatatgttggtgcgggaatgatctgctcacaccttgtaaacctctccgcgctctttggcgcaatactttcttgggggataatgtggccactgatcagcatacaaaagggtaagtggtatcctggaaatgttcctgaaagcagcatgacaagcttgtttggttacaagtccttcatgtgtgtagctttgatcatgggggatggcctttaccacttcataaaagtaacaggtatcactgctaagagcctgcatgaacgatccaatcgtagacatgctaagaaagcgacagatgaggatacatttgtaattgctgatatgcagcgtgacgagttcttcaacaaagactatattccaaactggctagcgtatgctggatatgccttactgagcattgttgcggtaattgcgatacccataatgttccaacaggtgaagtggtactatgttgttgtagcctttgtgcttgctcctgtgctgggattctccaatgcctatggaactgggctaactgacatgaacatgagctacaactatggcaagattgctctcttcatctttgcagcttggggagggagggacaacggtgtcattgctggtcttgttggttgtggaatagtgaagcagctagtacaagtctctgctgatttgatgcacgactttaagactggtcatctgacattaacatcaccaagatccatgcttgttgggcaggccattggtacagccatgggctgcataatcgctccactgactttcttgctcttctacaaagcatttgatattgggaaccctgatggatactggaaggctccatatgccctgatatttcgaaacatggccattcttggcgtcgagggcttttctgcactaccaaagcattgtcttgagctgtctgctggcttctttgcattttctgtgctcatcaaccttatgagggacttcttgccacgcaagtacagggattatgtgcccctgccgacggcaatggctgtgccattccttgttggtgcaaattttgctattgacatgtgtgtgggaagcctgatagtctttgcctggcacaagatcaacagcaaggagtctgcgttgctagtgccagcggttgcgtctggttttatttgtggagatggtatatggatgttcccttcttccctgctttcccttgctaaggttaagccaccaatctgcatgaagttcactcccggaagctag</cdnaseq>

Protein Sequence

<aaseq>MEAAAPEIERCDAGDVESDHDGAAAAAERVPPWREQVTARGMVA ALLIGFVYTVIIMKLALTTGIIPTLNVSAALLAFLALRGWTRAPALLLPGGGAASSSS RRRPFTRQENTVVQTCAVACYTMGFGGGFGSSLLALNRKTYELAGVSTPGNSPGSYKE PGVGWMTGFLFAISFVGLLNLLPLRKALIIDYKLTYPSGTATAVLINGFHTPQGENSA KKQVRGFLNCFGISLLWSFFQWFYTGGESCGFLQFPTFGLKAWKQTFYFDFSLTYVGA GMICSHLVNLSALFGAILSWGIMWPLISIQKGKWYPGNVPESSMTSLFGYKSFMCVAL IMGDGLYHFIKVTGITAKSLHERSNRRHAKKATDEDTFVIADMQRDEFFNKDYIPNWL AYAGYALLSIVAVIAIPIMFQQVKWYYVVVAFVLAPVLGFSNAYGTGLTDMNMSYNYG KIALFIFAAWGGRDNGVIAGLVGCGIVKQLVQVSADLMHDFKTGHLTLTSPRSMLVGQ AIGTAMGCIIAPLTFLLFYKAFDIGNPDGYWKAPYALIFRNMAILGVEGFSALPKHCL ELSAGFFAFSVLINLMRDFLPRKYRDYVPLPTAMAVPFLVGANFAIDMCVGSLIVFAW HKINSKESALLVPAVASGFICGDGIWMFPSSLLSLAKVKPPICMKFTPGS</aaseq>

Gene Sequence

<dnaseqindica>2374..3302#2175..2289#1894..2083#1656..1790#1479..1576#493..665#1..385#atggaagccgccgctcccgagatagagaggtgcgacgccggcgacgtggagtcggaccacgacggcgccgccgccgccgccgagcgcgtgccgccgtggcgcgagcaggtgacggcgcggggcatggtggcggcgctgctcatcggattcgtctacaccgtcatcatcatgaagctggcgctcaccacggggatcatccccacgctcaacgtctccgccgcgctcctcgccttcctcgcgctccgcggctggacgcgcgcgcccgccctcctcctccccggcggcggcgccgcctcctcctcctcccggcgccgccccttcacccgccaggagaacaccgttgtccagacctgcgccgtcgcctgctacaccatgggattcggcggtgcgcgccccgctactacttcctgtttgatttctctccccaagtctttcttaatttgttcttgcgatggcgcctgtatataaaattgggggatatcgtgcgcgcaggtgggttcgggtcgtcgctgctggctctgaacaggaagacgtacgagttggccggggtgagcacgccgggcaactcgccggggagctacaaggagcccggggtcgggtggatgaccggattcctgtttgcgattagcttcgttgggctccttaacttgcttccactcagaaaggtgtgtactttgcccacaatttttgttccgttggtactgaatatgcaatggattaaattagacctgtccctgcaaattcaggactctctggagttcctgctattatgttcgttaattgttgtgatttgctatctttcagtgaactgtttttttctctcagttttgtttcggatttttggagaatatagctcagttgttgcatgtgaaatctgtgctatattctcagttttgtgctgatattaaaaattgtgaactcactcctattttaagatgatattttacataaacaatctgttgttacatttgtaaatttgtctgatcccagtatacggataggtcatgttttcaagaaagactaggaagtttaagttacccatcagtctaccactatctgttttactttgttaggttcttgatctgctttatcttgctaacctttaaggctttaactagaactacttgttcagactccagagtaatgcacatcgtgtgcatggcatggaaacccaactaacctgcaacagttcaacaccaattgggagttctacatagtacacatcctaatatttggtatgcggcattacatttccattatccttaaccaacaagttgactaaagtgctaaaacgaaatgaacttttttgagacaaataaaatgtcatagactaaatgagacaactgtacacacgaattccctctagatactcttcttcaagtctaaaaaatttgtcattacaatctgtagtttgaagacagaaaccagttttctttgcatttgtctgtcccacctaatgatgtgcatgacgttttcaggctttgatcatagattataagttaacctatccaagtgggactgcaactgctgttcttataaacggattccatacccctcaaggagaaaatagtgcaaagtatggtccaggtctcacttgtgctaaatacatcatcgcagttcgtgatatgaattattaattctacttttcatgccaggaagcaagtccgcggatttctgaattgctttgggatcagcctcttatggagcttcttccagtggttctacactggtggagagagttgtgggtttcttcaattccctacctttggtctaaaggcttggaaacaaacgtatgcattattggtcacccattgtttgtacccctactttatgcataattgcatattcgtcaggcagccagattctcctaactaccaattttttttgctgcaggttctattttgatttcagcctcacatatgttggtgcgggaatgatctgctcacaccttgtaaacctctccgcgctctttggcgcaatactttcttgggggataatgtggccactgatcagcatacaaaagggtaagtggtatcctggaaatgttcctgaaagcagcatgacaagcttgtttggttacaaggtcaggcatacaatttacctttttctcaaaatagtctgatgtgaatccataattttatatggtacagtatctctaattttctccttctcagtccttcatgtgtgtagctttgatcatgggggatggcctttaccacttcataaaagtaacaggtatcactgctaagagcctgcatgaacgatccaatcgtagacatgctaagaaaggtaaacgtgctctgcgaaattaactatttccacgttttcttccctcttatatcaccaaggtagctgaagctgagtgaattgcagcgacagatgaggatacatttgtaattgctgatatgcagcgtgacgagttcttcaacaaagactatattccaaactggctagcgtatgctggatatgccttactgagcattgttgcggtaattgcgatacccataatgttccaacaggtgaagtggtactatgttgttgtagcctttgtgcttgctcctgtgctgggattctccaatgcctatggaactgggctaactgacatgaacatgagctacaactatggcaagattgctctcttcatctttgcagcttggggagggagggacaacggtgtcattgctggtcttgttggttgtggaatagtgaagcagctagtacaagtctctgctgatttgatgcacgactttaagactggtcatctgacattaacatcaccaagatccatgcttgttgggcaggccattggtacagccatgggctgcataatcgctccactgactttcttgctcttctacaaagcatttgatattgggaaccctgatggatactggaaggctccatatgccctgatatttcgaaacatggccattcttggcgtcgagggcttttctgcactaccaaagcattgtcttgagctgtctgctggcttctttgcattttctgtgctcatcaaccttatgagggacttcttgccacgcaagtacagggattatgtgcccctgccgacggcaatggctgtgccattccttgttggtgcaaattttgctattgacatgtgtgtgggaagcctgatagtctttgcctggcacaagatcaacagcaaggagtctgcgttgctagtgccagcggttgcgtctggttttatttgtggagatggtatatggatgttcccttcttccctgctttcccttgctaaggttaagccaccaatctgcatgaagttcactcccggaagctag</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0649900, RefSeq:Os02g0649900