Os06g0622700

From RiceWiki
Revision as of 16:05, 19 May 2014 by Li150706345 (talk | contribs) (Evolution)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Os06g0622700 is a homolog of ATbZIP60. The Os06g0622700 bZIP transcription factor plays a critical role in the induction of chaperone genes.[[during maturation was significantly higher than that of wildtype.

Figure1.RT-PCR expression profile of a rice bZIP transcription factor containing a TMD.

Figure1:(a) Expression during seed development. (b) Expression under ER stress conditions in callus. (c) Induction of GUS activity by T2 callus containing the Os06g0622700 promoter:GUS construct after treatment with 2 mM DTT for 6 h. The photographs on the bottom left show GUSstained calli with or without DTT treatment (scale bars = 1 mm). The bottom right panel shows quantitative measurement of GUS activity in these calli [4-methylumbelliferone (4-MU) production rate over 1 h]

Os06g0622700 is one of the most important transcription factors involved in signal transduction of the ER stress response in rice.

Figure2.Effect of Os06g0622700 on some chaperone gene promoters in rice suspension cultured cells.

Figure2:(a) Effector, reporter and control vector constructs are shown. Os06g0622700DC is the active form of the protein. (b) Fold change in GUS activity after transient expression.

The early stage of the ER stress response in rice is mediated by OsbZIP50 (Os06g0622700), OsbZIP39 (Os05g0411300) and OsbZIP60 (Os07g0644100).

Expression

Expression of many chaperone genes induced by the major BiP1 may be mainly mediated by binding of Os06g0622700 to UPRE or ERSE cis-elements, as expression ofmanychaperone genes induced byDTTtreatmentwasalso regulated by the Os06g0622700 bZIP transcription factor.

Evolution

Os06g0622700 is a homolog of ATbZIP60.

Os03g0102200 is a 14.5-kD polypeptide that is similar to DNA-directed RNA polymerase II, SDRP, while Os06g0622700 is a bZIP (for basic Leu zipper) transcription factor that shows the highest homology to AtbZIP60 in Arabidopsis (Supplemental Fig. S6), so we renamed it OsbZIP60.

Figure3.Structure of ZmbZIP17, and the alignment and phylogenetic tree generated with ER stress-associated membrane-associated bZIP factors from Arabidopsis, rice and maize.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os06g0622700

Description

Eukaryotic transcription factor, DNA-binding domain containing protein

Version

NM_001064635.1 GI:115469001 GeneID:4341554

Length

1991 bp

Definition

Oryza sativa Japonica Group Os06g0622700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:25918948..25920938

Sequence Coding Region

25918979..25919418,25919822..25920042,25920504..25920757

Expression

GEO Profiles:Os06g0622700

Genome Context

<gbrowseImage1> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:25918948..25920938 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacggaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctag</cdnaseq>

Protein Sequence

<aaseq>MDVEFFADLDLDALLASFSSSAAAAGSGVSGLFAPSPPHDAEAG SPESVSSRRPSPSREAALSEIERFLMEEGPAAEEGVGAEDFFDALLVDGGEEEEEEEG KGSEAGGSTDGDSGKENEVATPDAEKEDVEAEVDGDDPMSKKKRRQMRNRDSAMKSRE RKKMYVKDLETKSKYLEAECRRLSYALQCCAAENMALRQSLLKDRPVGAATAMQESAV LTETLPLVSLLWLVSIVCLLPVPGLPNRNPVARSSAGRDLATVTGKKTSSEQQLEETL LLHGRRCKGSRARIKLDTGPFRLAAAAC</aaseq>

Gene Sequence

<dnaseqindica>32..471#875..1095#1557..1810#gagagacaaaaatatctccatcgcgatctccatggatgtagagttcttcgccgacctcgacctcgacgcgctcctcgcctccttctcctcctccgccgccgccgccggctccggcgtctcgggcctcttcgccccgtcaccgccgcacgatgcggaggcggggtcgccggagtcggtgagctcccggcggcccagcccttcccgggaggcggcgctgtcggagatcgagaggttcctgatggaggagggccccgcggcggaggagggggtcggcgcggaggatttcttcgacgcgctgctcgtcgacggcggggaggaggaggaggaagaagaggggaaggggagtgaggcggggggaagcacggatggggattccgggaaggagaatgaggtggctaccccggacgcggagaaggaggatgtggaggcggaggtggatggcgatgatcccatgagcaagaagaagaggaggtatgtatgaattgcctaaaaacttgggatttctaaaaatcagggggatttcgtgtgtacaaagatttgtgaatttacataggtagctaggaataatggtcaggttttagttcaacacaattgatcttattcagtgagtgccagaagtccagaaccgcactacacccatagtacattttttttattaattaaaacattatatatgtacatacatgagtatatgatctaatttgtcgtaataagatgcatggtctttttagtgctaatcctttgtgaaattgtaagaaattgctaggctttcaattataagagtgtatggtcttttcaactataagatgttttccgtaatcaaagatgttctagttagacaataatctaatagtatgtgttatgaatttatcaggcagatgagaaatagggattctgccatgaaatcgagggagaggaagaagatgtatgttaaggacctagagactaagagcaagtatctagaggccgagtgtcgtcgcctcagctacgcgcttcagtgctgcgcagctgagaacatggcgctgcgccagagcttgttgaaggataggcctgtcggtgccgccacagccatgcaggagtctgccgtactcacgggtaagacatatcgacaacattttctgtttcatacttctatttcgacatggatgaacaaatcttttcttgccgatcattttgaattgctcagtatgctgacaaacttgtgcttggcatcaatatattcggtgtggtctcatggatgatccgcctaagctaatttttgttgaattcccatgaaatcaaacagctagctattgtagttatagccaattgttgactacattttctgtgtacaagtatgcgtggtttatgcacaaatctgcattgtttatacaataacacttgcttagccttttgttttccaactttggacctaatcagtcaccgaccgaagttgacattaactggaacatggtttctttgctatcctacagtatgcttgagtcataatcctgatgctcctacagtatatttgtgtcataaacctgatgctaaaggtaaccttttcctgtttgcagaaaccctgccgctggtttccctgctttggctcgtgagcatcgtgtgcctactcccggtgcccggtctacccaaccgaaacccggtggctcgaagcagcgccggaagagatctcgcgacggtaaccggaaagaagacaagcagtgaacaacagctagaagaaacattactactccatgggaggcgttgcaagggctcgagggcgaggatcaagctagataccggaccgttccgtttagcagcagctgcttgctaggctgccgcttccttgcaaagttgtttccagtctgtattgtagctagcaaatcaaattggcgtgtctatcgcctgtcgtgctgccgcttatccatggactatctttttctttttttggttccttccccccttgtttttataatatcctcctatgcataatgcattatccaggtagttttgaa</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0622700, RefSeq:Os06g0622700