Os05g0553400

From RiceWiki
Revision as of 12:58, 20 May 2014 by RongYinlong (talk | contribs) (References)
Jump to: navigation, search

The rice gene OsMYB55 can enhance the vegetative growth and improve grain yield of rice growth under high temperature conditions.

Annotated Information

Function

OsMYB55 is a transcription factor of R2R3-MYBs family members.OsMYB55 binds to the promoter regions of target genes and directly activates expression of some of several genes involved in amino acids metabolism including glutamine synthetase (OsGS1;2) glutamine amidotransferase(GAT1) and glutamate decarboxylase 3 (GAD3).The MYB plant transcription factor family members regulate numerous processes during the plant life cycle and are also involved in response to various environmental stresses [1].The MYB proteins are classified into three major groups based on the number of adjacent repeats in the binding domain; R1R2R3-MYB, R2R3-MYB, and R1-MYB. Most plant MYB proteins are of the R2R3 type.The R2R3-MYBs are involved in a wide range of physiological responses such as regulation of the isopropanoid and flavonoid pathways,control of the cell cycle, root growth,and various defense and stress responses [2].Molecular and biochemical analysis revealed that OsMYB55 enhances amino acid metabolic pathways crucial for normal plant growth and development under high temperature.

Expression

OsMYB55 is more Specifically Expressed at the Vegetative Stage.Expression analysis of the OsMYB55 revealed that transcript levels are higher at the vegetative stages up to tillering and the inflorescence stage. The transcription was higher in the root tissues compared to the leaves at these stages. However, its lowest expression level was observed in all seed development stages and at seed maturation.Expression analysis of the transgenic plants showed that OsMYB55 transcript levels were between fifty and ninety times higher in the transgenic lines than in the wild type plants

Evolution

The 867 bp full length cDNA sequence of OsMYB55(Os05g0553400) encodes a R2R3-MYB transcription factor predicted to be 289 amino acids long. This gene was identified for nitrogen regulated genes. The BLAST search program for identifying homologs of OsMYB55 shows Oryza Sativa (Os05g0553400), Sorghum bicolor (242088749), Zea mays (226509454), Vitis vinifera (296081600), Populus trichocarpa (224092242), Malus x domestica (71041104), Dacus carota (134026414), Glycine max (255642827) and Arabidopsis thaliana (15242793).

Labs working on this gene

Please input related labs here.

References

Smolen GA, Pawlowski L, Wilensky SE, Bender J (2002) Dominant alleles of the basic helix-loop-helix transcription factor ATR2 activate stress-responsive genes in Arabidopsis. Genetics 161: 1235–1246.

Structured Information

Gene Name

Os05g0553400

Description

Similar to Myb-related transcription factor-like protein (MYB transcription factor)

Version

NM_001062798.1 GI:115465326 GeneID:4339548

Length

1457 bp

Definition

Oryza sativa Japonica Group Os05g0553400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:27606367..27607823

Sequence Coding Region

27606601..27607204,27607297..27607426,27607530..27607665

Expression

GEO Profiles:Os05g0553400

Genome Context

<gbrowseImage1> name=NC_008398:27606367..27607823 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:27606367..27607823 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggcgcgcgccgtgctgcgacaaggcgagcgtgaagcgggggccgtggtcgccggaggaggacgagcagctgcggagctacgtccagagccacggcatcggcggcaactggatcgcgctcccgcagaaagcagggctcaaccgctgcggcaagagctgcaggctccggtggctcaactacctgaggccggacatcaagcacggcggctacaccgagcaggaggaccacatcatctgctcgctctacaactcgattggaagcaggtggtccatcatcgcgtcgaagctccccggccggactgacaacgacgtcaagaactactggaacaccaagctcaagaagaaagccatgggcgccgtgcagccgcgcgccgccgcctcggcgccgagccaatgcacgtcgtcagcgatggcgccggcgctctcgccggcctcctcgtccgtcaccagctcgagcggcgacgcctgcttcgccgccgccgccaccaccaccaccaccatgtacccgccaccgacgacgccgccgcagcagcagttcatccgcttcgacgcaccacccgcggcggcggcggcggcatccccgaccgacctcgcgcccgtgccaccaccggccaccgtcacggcggacggcgacggcggctgggcgtccgacgccttgtccctcgacgacgtgttcctcggcgagctcacggccggcgagccgctgttcccttacgccgagctgttcagcggcttcgccggcgcggcgccggacagcaaggccaccttggagctctcggcgtgctacttcccgaacatggcggagatgtgggcggcctccgaccacgcctacgccaagccacagggtctctgcaacaccctgacatag</cdnaseq>

Protein Sequence

<aaseq>MGRAPCCDKASVKRGPWSPEEDEQLRSYVQSHGIGGNWIALPQK AGLNRCGKSCRLRWLNYLRPDIKHGGYTEQEDHIICSLYNSIGSRWSIIASKLPGRTD NDVKNYWNTKLKKKAMGAVQPRAAASAPSQCTSSAMAPALSPASSSVTSSSGDACFAA AATTTTTMYPPPTTPPQQQFIRFDAPPAAAAAASPTDLAPVPPPATVTADGDGGWASD ALSLDDVFLGELTAGEPLFPYAELFSGFAGAAPDSKATLELSACYFPNMAEMWAASDH AYAKPQGLCNTLT</aaseq>

Gene Sequence

<dnaseqindica>620..1223#398..527#159..294#atcggtcggtctcggtcgctgccgtccctgtgcttggagtagacacgagccggtgacgcgcatatcgtcttctgctcgagatcgatcgatcgatcgcttggttggttgctgcgactgcgagggaggccgcgggtggtgaggaggattgtgcaaaaaaaatggggcgcgcgccgtgctgcgacaaggcgagcgtgaagcgggggccgtggtcgccggaggaggacgagcagctgcggagctacgtccagagccacggcatcggcggcaactggatcgcgctcccgcagaaagcaggtcggtattagtgcactgctcgtcgtcgtcgatgctagccggtgatgaaacgccatgtttgtatgtgaattctgatgtctgcgtgttctcttgtgtgattcagggctcaaccgctgcggcaagagctgcaggctccggtggctcaactacctgaggccggacatcaagcacggcggctacaccgagcaggaggaccacatcatctgctcgctctacaactcgattggaagcaggtgatgatttaagccggagatgaatatttcttttttctttcactgatcctgttctgagttcttgaactgactctgtttgcgtgcgttgccaggtggtccatcatcgcgtcgaagctccccggccggactgacaacgacgtcaagaactactggaacaccaagctcaagaagaaagccatgggcgccgtgcagccgcgcgccgccgcctcggcgccgagccaatgcacgtcgtcagcgatggcgccggcgctctcgccggcctcctcgtccgtcaccagctcgagcggcgacgcctgcttcgccgccgccgccaccaccaccaccaccatgtacccgccaccgacgacgccgccgcagcagcagttcatccgcttcgacgcaccacccgcggcggcggcggcggcatccccgaccgacctcgcgcccgtgccaccaccggccaccgtcacggcggacggcgacggcggctgggcgtccgacgccttgtccctcgacgacgtgttcctcggcgagctcacggccggcgagccgctgttcccttacgccgagctgttcagcggcttcgccggcgcggcgccggacagcaaggccaccttggagctctcggcgtgctacttcccgaacatggcggagatgtgggcggcctccgaccacgcctacgccaagccacagggtctctgcaacaccctgacataggaggacacgctaaaacctccattgaattcttgcgtagctgcgaacgcaacggcgatcgatcgatgcgtcgccacttgctactagcataattcttgctctcttttttttttcaatttttttctcttcttcgagtggcccattctctagctggcgttttctcgtgtattatgagtgatcgattattacatgtaaattaatccatagatgtatctgcactgatccaaattctccagc</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0553400, RefSeq:Os05g0553400

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2