Os06g0165600
Please input one-sentence summary here.
Contents
Annotated Information
Function
The OsDREB1D, a special DREB (dehydration responsive element binding protein) homologous gene, whose transcripts cannot be detected in rice (Oryza sativa L), either with or without stress treatments, was amplified from the rice genome DNA.[1][2][3]. The over-expression of OsDREB1D,a gene encoding a protein that is the closest homolog of the C-repeat (CRT)binding factor/dehydration-responsiveelementbinding protein 1(CBF/DREB1) in rice, conferred cold and high-salt tolerance in transgenic plants, and that transgenic plants were also insensitive to ABA (abscisic acid).[1][3][4][5]. This OsDREB1D gene functions similarly as other DREB transcription factors [1].
Expression
The expression of OsDREB1D in rice may be controlled by a special mechanism for the redundancy of function[1].OsDREB1D gene expression was up-regulated by drought stress and ABA treatment, but not by low temperature. Over-expression of CBF4 in transgenic Arabidopsis plants improved tolerance to freezing and drought stress. The OsDREB1D mRNA in any organs including roots, leaves, shoots, growing points, spike at late bolting stage and seeds of rice (Oryza sativaL.) with, or without stress treatments. The expression of OsDREB1D is not detected in rice plants, either with or without stress treatment. However,an independent group submitted the cDNA sequence for OsDREB1D to GeneBank (AF243384.1). Therefore, it is possible that OsDREB1D is expressed in a different specific growth stage or organ. The mRNA of OsDREB1D was likely to be degraded in particular developmental stage for its redundant function[1].
DNA-gel blot analysis of OsDREB1D revealed multiple bands, implying multiple copies. The OsDREB1D mRNA was not detected in any plants either with or without stress treatments[2].
| Primer | Forward primer | Reverse primer |
|---|---|---|
| Gene amplication | 5’ -TCGTTGTAGTAGCTCTGGTG-3’ | 5’-GGAAAAAGTTACCTCCTCCATCGAGCTC-3’[1] |
| RT-PCR | 5’-CGGCTGGGGTAAAGAAGTTGTC-3’ | 5’-CATGAGTCTCCGGGAGGAAGTG-3’[1] |
Evolution
We previously classified 145 ERF/AP2-related proteins in Arabidopsisinto five groups–AP2 subfamily, RAV subfamily, DREB subfamily, ERF subfamily, and one very specific gene,AL079349–on the basis of similarity of the amino acid sequence of the DNA-binding domain [6](Figure 4). The DREB subfamily proteins were further divided into six subgroups, A-1–A-6 [6]. We analyzed the similarities of the ERF/AP2 domains of the OsDREB proteins and compared them with those inArabidopsisand other genera. The OsDREB1 proteins were classified into the A-1 (DREB1/CBF) subgroup. The DREB1-type ERF/AP2 domains in the three monocots were closely related to each other but distant from those in the dicots [2][6].
Phylogenetic analysis was carried out based on the similarities of AP2 domains in AP2/EREBP proteins from rice and Arabidopsis(Fig. 5). The OsDREB1D was closest to OsDREB1A on the phylogenetic tree. These two genes show 70% identity at the amino acid level over the entire ORFs (data not shown), and they are the highest homologs in the genes included in the phylogenetic tree. It seems likely that OsDREB1D and OsDREB1A may be orthologous and play similar roles under stress conditions.[1].
Knowledge Extension
The DREB proteins contain an ERF/AP2 DNA-binding domain. The ERF/AP2 domain is quite conserved in Fig.6.[3].
The DREB1/CBF1-type NLS consensus PKRPAGRTKFRETRHP distinguishes these proteins from other ERF/AP2 proteins. The DSAW motif at the end of the ERF/AP2 domain and LWSY motif at the end of the C-terminal are conserved in most of the DREB1-type proteins. Phylogenetic relationship among some of the reported DREB-type proteins is shown in Fig.7. [3].
Labs working on this gene
- College of Bioscience and Biotechnology, Yangzhou University, Yangzhou 225009, China
- Biotechnology Research Institute, Shanghai Academy of Agricultural Sciences, Shanghai 201106, China
- Biological Resources Division, Japan International Research Center for Agricultural Sciences (JIRCAS), 1-1 Ohwashi, Tsukuba, Ibaraki 305-8686, Japan
- Japan Society for the Promotion of Science, 4-1-8 Motomachi, Kawaguchi, Saitama 332-0012, Japan
- Laboratory of Plant Molecular Biology, RIKEN Tsukuba Institute, 3-1-1 Koyadai, Tsukuba, Ibaraki 305-0074, Japan
- Plant Functional Genomics Research Group, RIKEN Genomic Sciences Center, 1-7-22 Suehiro-cho, Tsurumi-ku, Yokohama City, Kanagawa 230-0045, Japan
- Key Laboratory of Agro-Ecological Processes in Subtropical Region, Institute of Subtropical Agriculture, Chinese Academy of Sciences, Changsha,China
- Department of Life Science, Sogang University, Seoul 121-742, Korea
References
- ↑ 1.00 1.01 1.02 1.03 1.04 1.05 1.06 1.07 1.08 1.09 1.10 Zhang Y, et al. (2009) Expression of a rice DREB1 gene, OsDREB1D, enhances cold and high-salt tolerance in transgenic Arabidopsis. BMB reports 42(8):486-492.
- ↑ 2.0 2.1 2.2 Dubouzet JG, et al. (2003) OsDREB genes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. The Plant journal : for cell and molecular biology 33(4):751-763.
- ↑ 3.0 3.1 3.2 3.3 3.4 3.5 Agarwal P, Agarwal P, Reddy MK, & Sopory S (2006) Role of DREB transcription factors in abiotic and biotic stress tolerance in plants. Plant Cell Rep 25(12):1263-1274.
- ↑ Mao D & Chen C (2012) Colinearity and Similar Expression Pattern of Rice <italic>DREB1s</italic> Reveal Their Functional Conservation in the Cold-Responsive Pathway. PloS one 7(10):e47275.
- ↑ Lee SC, Kim SH, & Kim SR (2013) Drought inducible OsDhn1 promoter is activated by OsDREB1A and OsDREB1D. Journal of Plant Biology 56(2):115-121.
- ↑ 6.0 6.1 6.2 6.3 6.4 Sakuma Y, et al. (2002) DNA-Binding Specificity of the ERF/AP2 Domain of Arabidopsis DREBs, Transcription Factors Involved in Dehydration- and Cold-Inducible Gene Expression. Biochemical and Biophysical Research Communications 290(3):998-1009.
Structured Information
| Gene Name |
Os06g0165600 |
|---|---|
| Description |
CRT/DRE binding factor (Transcription factor RCBF4) |
| Version |
NM_001063444.1 GI:115466619 GeneID:4340239 |
| Length |
904 bp |
| Definition |
Oryza sativa Japonica Group Os06g0165600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 6:3309920..3310823 |
| Sequence Coding Region |
3309944..3310705 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008399:3309920..3310823 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008399:3309920..3310823 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggagaagaacaccgccgccagcgggcaattgatgacctcctccgcggaggcgacgccgtcgtcgccgaagcggccggcggggcgaaccaagttccaggagacgaggcacctagtgttccgtggggtgcgatggcgtgggtgcgcggggcggtgggtgtgcaaggtgcgtgtcccgggcagccgcggtgaccgtttctggataggcacgtctgacaccgccgaggagaccgcgcgcacgcacgacgccgccatgctcgccttgtgcggggcctccgccagcctcaacttcgccgactctgcctggctgctccacgtcccgcgcgcccccgtcgtctccggactccggccaccagctgcccgatgtgcaacgcgctgcctgcaaggccatcgccgagttccagcgccgggccgggggagcaccgccactgccactgccacctccggcgatgctgcatcgaccgctcctccgtcggcacccgttctgtcagccaaacaatgcgaattcatctttctttcttcactagattgttggatgttaatgtcaaagcttatcagcagtagcagagcaaaaggatcgttgtgcctgcgaaaaaatcccatttcattttgcatggttacaaattcttacactgctcttttgctcgaatacattatattgcagatgaattcaatgatcgttttaatccacgaattatcaaaatatcaagtctttctgctactaaccatgataacacaccacctttttcaatggaggaggtag</cdnaseq> |
| Protein Sequence |
<aaseq>MEKNTAASGQLMTSSAEATPSSPKRPAGRTKFQETRHLVFRGVR WRGCAGRWVCKVRVPGSRGDRFWIGTSDTAEETARTHDAAMLALCGASASLNFADSAW LLHVPRAPVVSGLRPPAARCATRCLQGHRRVPAPGRGSTATATATSGDAASTAPPSAP VLSAKQCEFIFLSSLDCWMLMSKLISSSRAKGSLCLRKNPISFCMVTNSYTALLLEYI ILQMNSMIVLIHELSKYQVFLLLTMITHHLFQWRR</aaseq> |
| Gene Sequence |
<dnaseqindica>25..786#actgcttgagacgtcgcacacgtcatggagaagaacaccgccgccagcgggcaattgatgacctcctccgcggaggcgacgccgtcgtcgccgaagcggccggcggggcgaaccaagttccaggagacgaggcacctagtgttccgtggggtgcgatggcgtgggtgcgcggggcggtgggtgtgcaaggtgcgtgtcccgggcagccgcggtgaccgtttctggataggcacgtctgacaccgccgaggagaccgcgcgcacgcacgacgccgccatgctcgccttgtgcggggcctccgccagcctcaacttcgccgactctgcctggctgctccacgtcccgcgcgcccccgtcgtctccggactccggccaccagctgcccgatgtgcaacgcgctgcctgcaaggccatcgccgagttccagcgccgggccgggggagcaccgccactgccactgccacctccggcgatgctgcatcgaccgctcctccgtcggcacccgttctgtcagccaaacaatgcgaattcatctttctttcttcactagattgttggatgttaatgtcaaagcttatcagcagtagcagagcaaaaggatcgttgtgcctgcgaaaaaatcccatttcattttgcatggttacaaattcttacactgctcttttgctcgaatacattatattgcagatgaattcaatgatcgttttaatccacgaattatcaaaatatcaagtctttctgctactaaccatgataacacaccacctttttcaatggaggaggtaggcgcggacgccctcgccatcatcgtcgatgtcgccactgatgacgaggtccgcgccgctcaccagctcgcacgcctcgtcgtcgtccatgctcgccacctcggtccagcagctgaacc</dnaseqindica> |
| External Link(s) |