Os06g0286700

From RiceWiki
Revision as of 02:22, 23 May 2014 by Cydta (talk | contribs) (Nucleotide Polymorphism of the Pi9 Alleles)
Jump to: navigation, search

This is a broad-spectrum resistance(R) gene to rice blast

Annotated Information

尼松伟

Function

Blast is a very common disease found in rice. Blast causes immense damage to rice in rice-growing countries .And Pi9 alleles are mainly responsible for resistance to rice blast. We can use Pi1 and pi2 to improve the resistance ability to blast through hybridization.

The rice disease blast, caused by the fungus Magnaporthe oryzae, is one of the most devastating diseases afflicting the rice crop [1]and is best combated by the deployment of genetic resistance [2].


Expression

editing We test the relationship between Pi1,Pi2 and D12 gene in expression. When Pi1,Pi2 and D12 gene unit together, they will improve the resistance to blast by a great deal in the field condition.Pi9 gene lies on the chromosome6.

Evolution

Selection of the Pi9 Alleles.png[3]

To evaluate the phylogenetic relationship among the Pi9 alleles, we constructed neighbor-joining trees using the full-length fragment, the NBS region, and the LRR region. The analysis indicated that all these alleles are clustered into the same clade and belong to the same NBS-LRR sub-family. Two obvious haplotypes are distinguishable in the phylogenetic tree. Group I is mainly composed of the Asian cultivated rice O. sativa and its two ancestors, O. nivara, and O. rufipogon. Most of the African cultivated rice O. glaberrima and its ancestor O. barthii are clustered in group II. These results suggest that different selection pressures have occurred in the two unique groups of the Oryza species during domestication and/or natural selection.[3]


Nucleotide Polymorphism of the Pi9 Alleles

Nucleotide polymorphism of the Pi9 alleles.png[3]

Of 2,927 nucleotides, 435 polymorphic sites including alignment gaps (∼18.9%) were detected among the 40 sequences using the DnaSP program. An intermediate-diversified nucleotide diversity (π=0.03348, P=0.000293) for the Pi9 alleles was observed based on the previously published criteria [4]. The average nucleotide diversity of the LRR region (π=0.04554, P=0.00354; θ=0.04307, P=0.01263) is much higher than that of the NBS region (π=0.02098, P=0.00194; θ=0.02746, P=0.00816). Both values are similar in cultivated rice and wild rice groups. These results suggest that the LRR domain is important in the variation of the Pi9 alleles.


You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. 1.National Key Laboratory of Crop Genetic Improvement, 2.National Center of Plant Gene Research and National 3.Center of Crop Molecular Breeding, Huazhong 4.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 5.National Key Laboratory of Crop Genetic Improvement, Huazhong Agricultural University, Wuhan 6. 2Guangxi Key Laboratory of Subtropical Bioresource Conversation and Utilization,Nanning

References

Please input cited references here. 1.H. L. Chen, B. T. Chen, D. P. Zhang, Y. F. Xie, and Qifa Zhang, 2001, Pathotypes of Pyricularia grisea in Rice Fields of Central and Southern China, Plant Disease 85:843-850. 2 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302 3. H. Jiang ,Y. Feng , L. Bao ,X. Li, G. Gao, Q. Zhang , J. Xiao , C. Xu _ Y. He,2012, Improving blast resistance of Jin 23B and its hybrid rice by marker-assisted gene pyramiding, Mol Breeding (2012) 30:1679–1688 4. Zhao P,Feng R.R,Xiao Q Zh,Yang P.Zh,Lin. W,Liu P.Q,Li.RB,2013,Pyramiding brown planthopper genes, bph20(t)and bph21(t),and rice blast resistant gene Pi9 in rice (Oryza sativa L.), Journal of Southen Agricalture,44(6):885-892

<references>


Structured Information

Gene Name

Os06g0286700

Description

Similar to NBS-LRR disease resistance protein homologue

Version

NM_001063943.1 GI:115467617 GeneID:4340778

Length

2957 bp

Definition

Oryza sativa Japonica Group Os06g0286700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:10386510..10389466

Sequence Coding Region

10386510..10386566,10386662..10389466

Expression

GEO Profiles:Os06g0286700

Genome Context

<gbrowseImage1> name=NC_008399:10386510..10389466 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008399:10386510..10389466 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</cdnaseq>

Protein Sequence

<aaseq>MQAFLRAAEVMKKKDELLKLVKLRERHRIAIRIHNLKSRVEEVS SRNTRYNLVEPISSGTEDDMDSYAEDIRNQSARNVDEAELVGFSDSKKRLLEMIDTNA NDGPAKVICVVGMGGLGKTALSRKIFESEEDIRKNFPCNAWITVSQSFHRIELLKDMI RQLLGPSSLDQLLQELQGKVVVQVHHLSEYLIEELKEKRYFVVLDDLWILHDWNWINE IAFPKNNKKGSRIVITTRNVDLAEKCATASLVYHLDFLQMNDAITLLLRKTNKNHEDM ESNKNMQKMVERIVNKCGRLPLAILTIGAVLATKQVSEWEKFYEHLPSELEINPSLEA LRRMVTLGYNHLPSHLKPCFLYLSIFPEDFEIKRNRLVGRWIAEGFVRPKVGMTTKDV GESYFNELINRSMIQRSRVGIAGKIKTCRIHDIIRDITVSISRQENFVLLPMGDGSDL VQENTRHIAFHGSMSCKTGLDWSIIRSLAIFGDRPKSLAHAVCPDQLRMLRVLDLEDV TFLITQKDFDHIALLCHLKYLSIGYSSSIYSLPRSIGKLQGLQTLNMPSTYIAALPSE ISKLQCLHTLRCIGQFHYDNFSLNHPMKCITNTICLPKVFTPLVSRDDRAKQIAELHM ATKSCWSESFGVKVPKGIGKLRDLQVLEYVDIRRTSSRAIKELGQLSKLRKLGVTTNG STKEKCKILYAAIEKLSSLQSLHVDAVLFSGIIGTLECLDSISSPPPLLRTLRLNGSL EEMPNWIEQLTHLKKFDLRRSKLKEGKTMLILGALPNLMVLYLYRNAYLGEKLVFKTG AFPNLRTLCIYELDQLREIRFEDGSSPLLEKIEIGKCRLESGIIGIIHLPKLKEIPIT YGSKVAGLGQLEGEVNTHPNRPVLLMYSDRRYHDLGAEAEGSSIEVQTADPVPDAEGS VTVAVEATDPLPEQEGESSQSQVITLTTNDRSVTPYMAA</aaseq>

Gene Sequence

<dnaseqindica>1..57#153..2957#atgcaggcattccttagagctgctgaagttatgaaaaagaaagatgaactattaaaggtttgggcagagcaaatacgtgacctgtcgtatgacattgaagattccctgatgaatttaaagtccatattgaaagccaaaccctatttcgtcagttggtgaaacttagagagcgccaccggatcgctatccgtatccacaacctcaaatcaagagttgaagaagtgagtagcaggaacacacgctacaatttagtcgagcctatttcctccggcacagaggatgacatggattcctatgcagaagacattcgcaatcaatcagctcgaaatgtggatgaagctgagcttgttgggttttctgactccaagaaaaggctgcttgaaatgatcgataccaatgctaatgatggtccggccaaggtaatctgtgttgttgggatgggtggtttaggcaagacagctctttcgaggaagatctttgaaagcgaagaagacattaggaagaacttcccttgcaatgcttggattacagtgtcacaatcatttcacaggattgagctacttaaagatatgatacgccaacttcttggccccagttctctggatcaactcttgcaagaattgcaagggaaggtggtggtgcaagtacatcatctttctgagtacctgatagaagagctcaaggagaagaggtactttgttgttctagatgatctatggattttacatgattggaattggataaatgaaattgcatttcctaagaacaataagaagggcagtcgaatagtaataaccactcggaatgttgatcttgcggagaagtgtgccacagcctcactggtgtaccaccttgatttcttgcagatgaacgatgccataacattgctactgagaaaaacaaataaaaatcatgaagacatggaatcaaataaaaatatgcaaaagatggttgaacgaattgtaaataaatgtggtcgtctaccattagcaatacttacaataggagctgtgcttgcaactaaacaggtgtcagaatgggagaaattctatgaacaccttccttcagaactagaaataaacccaagcctggaagctttgaggagaatggtgaccctaggttacaaccacctaccatcccatctgaaaccatgctttttgtatctaagtatctttcctgaggattttgaaatcaaaaggaatcgtctagtaggtagatggatagcagaagggtttgttagaccaaaggttgggatgacgactaaggatgtcggagaaagttactttaatgagctaatcaaccgaagtatgattcaacgatcaagagtgggcatagcaggaaaaattaagacttgtcgaattcatgatatcatccgtgatatcacagtttcaatctcgagacaggaaaattttgtattgttaccaatgggagatggctctgatttagttcaggaaaacactcgccacatagcattccatgggagtatgtcctgcaaaacaggattggattggagcattattcgatcattagctatttttggtgacagacccaagagtctagcacatgcagtttgtccagatcaattgaggatgttacgggtcttggatcttgaagatgtgacattcttaatcactcaaaaagatttcgaccatattgcattgttgtgccacttgaaatacttgagtattggatattcgtcatccatatattcacttcccagatccattggtaaactacagggcctacaaactttgaacatgccgagcacatacattgcagcactaccaagtgagatcagtaaactccaatgtctgcatactcttcgttgtataggacagtttcattatgacaactttagtctaaaccacccaatgaagtgcataactaacacaatatgcctgcctaaagtattcacacctttagttagtcgcgatgatcgtgcaaaacaaattgctgaattgcacatggccaccaaaagttgctggtctgaatcattcggtgtgaaggtacccaaaggaataggtaagttgcgagacttacaggttctagagtatgtagatatcaggcggaccagtagtagagcaatcaaagagctggggcagttaagcaagctgaggaaattaggtgtgacaacaaacgggtcgacaaaggaaaaatgtaagatactttatgcagccattgagaagctctcttccctccaatctctccatgtggatgctgtgttattctcaggtattattggaacacttgagtgcctagattctatttcatctcctcctcccctactaaggacactcaggttgaatggaagtcttgaagagatgcctaactggattgagcagctcactcacctgaagaagttcgacttacggaggagtaaactaaaggaaggtaaaaccatgctgatacttggggcattgcccaacctcatggtcctttatctttatcggaatgcttaccttggggagaagctagtattcaaaacgggagcattcccaaatcttagaacactttgtatttacgaattggatcagctaagagagatcagatttgaggacggcagctcacccctgttggaaaagatagaaataggcaagtgcaggttggaatctgggattattggtatcattcaccttccaaagctcaaggagattccaattacatacggaagtaaagtggctgggcttggtcagctggagggagaagtgaacacacacccaaatcgccccgtgctgctaatgtacagtgaccgaaggtatcacgacctgggggctgaagccgaaggatcttctatagaagtgcaaacagcagatcctgttcctgatgccgaaggatcagtcactgtagcagtggaagcaacggatccccttcccgagcaggagggagagagctcgcagtcgcaggtgatcacgttgacgacgaatgataggtcagtcactccctacatggcagcttaa</dnaseqindica>

External Link(s)

NCBI Gene:Os06g0286700, RefSeq:Os06g0286700

  1. 1.0 1.1 Ou SH (1985) Rice Disease, 2nd edn. Commonwealth MycologicalInstitute, Kew Surrey, pp 109–201
  2. 2.0 2.1 Bonman J, Khush G, Nelson R (1992) Breeding rice for resistance to pests. Annu Rev Phytopathol 30:507–528
  3. 3.0 3.1 3.2 3.3 J. Liu : Y. Hu: Y. Ning : N. Jiang : J. Wu : Y. Xiao : X. Liu, L. Dai : G.-L. Wang2011, Genetic Variation and Evolution of the Pi9 Blast Resistance Locus in the AA Genome Oryza Species, J. Plant Biol. (2011) 54:294–302
  4. 4.0 4.1 Yang S, Gu T, Pan C, Feng Z, Ding J, Hang Y, Chen J, Tian D (2008) Genetic variation of NBS-LRR class resistance genes in rice lines. Theor Appl Genet 16:165–177