Os11g0639100
Please input one-sentence summary here.
Contents
Annotated Information
This gene(Pikh; Pi54; Pi54rh) confers a high degree of resistance to diverse strains of the fungus Magnaporthe oryzae. The rice blast resistance gene Pi-kh has been isolated from the indica rice line Tetep showing resistance to different M. oryzae strains in the North-Western Himalayan region of India [1].
Function
Pi54 (Pi-kh cloned from the rice line Tetep) confers broad spectrum resistance against geographically diverse strains of M. oryzae collected from various parts of India and the US [2]. In order to develop sustainably successful blast-resistant rice lines, a comprehensive dissection of the reactions downstream of R–Avr interactions is highly desirable.The co-expression patterns of bacterial disease resistance genes and their transcriptional regulators in transgenic rice have indicated that the resistance genes trigger an immune response [3]. The expression
patterns of defence response genes involved in rice–M. oryzae interaction have been widely studied [4].
[4]
Expression
editing
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
1.National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,India.
2.Department of Biotechnology, Himachal Pradesh University, India.
References
<references>
Structured Information
| Gene Name |
Os11g0639100 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001189745.1 GI:297728620 GeneID:9272143 |
| Length |
1021 bp |
| Definition |
Oryza sativa Japonica Group Os11g0639100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 11:27105883..27106903 |
| Sequence Coding Region |
27105883..27106477,27106689..27106903 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008404:27105883..27106903 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008404:27105883..27106903 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</cdnaseq> |
| Protein Sequence |
<aaseq>MAKLQEKEKLETLMLRWNMDAGNASRIDHEVLETLQPNQCLKTL EIVAYEGHAFPSWITSTEPYLTSLVEISLEVWEQSSRMNLFPRLAELVIIQCPKLRAL HMEFPSIEKLILWMNNKMLYSSKEGLRGVEKSLENLSISFCEELHASSGCEGLQALDR LKKLEICGCHELSCLPQGLQHLSSLASLKIDNCNKLEILPEWLENLPFLQIMCLSGCP ILHSIPEGLTCSDIIVEYCPNFKEPSGMSSVLCSWKAMFLIFIELFLKQLN</aaseq> |
| Gene Sequence |
<dnaseqindica>427..1021#1..215#atggcaaaacttcaagagaaagaaaagctcgagacattgatgttgaggtggaatatggatgctggaaatgccagtagaatagatcatgaagtacttgaaaccctccaacctaaccagtgcctgaaaactttggagattgttgcgtatgaaggacatgcatttccatcttggataacaagcactgagccatatctcacatctctggttgagataaggttggttaatctgagatcatgtgaaaatgctttacctccacttgggctactgccatgtctgaagattgtggagataagccgagtttttttttttttgcgaggaagtggagataagccgagttgagaatatcagttgtattgacgataatttctatggtcagaacggtacatttccttcattggagaagctgattctctcattcatgactagccttgaagtctgggaacagtcatctaggatgaatctgtttcctcgtcttgcagaacttgtcatcattcagtgcccaaaattgagagcactgcatatggagtttccatcgattgaaaaattgattttgtggatgaataataagatgttgtacagctcgaaggaaggtctgagaggtgtagagaagagcctcgaaaatctttcaatttctttctgtgaagagttgcatgcttcttcaggctgtgagggtctacaggctcttgatcgcctcaagaagttggagatatgtggttgtcatgaattgtcatgcctcccacagggtttgcagcatctttcctctctcgccagcttgaaaattgataactgcaacaaattggagattttgccagaatggttggagaacctaccttttctacagataatgtgtttgtctggctgtccaattctgcactccattcctgaaggcctaacatgtagcgacattattgttgaatattgccccaattttaaagaaccatcaggtatgtcatcagtgctctgttcatggaaagccatgtttctgattttcattgagctattcttaaagcaattgaactag</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 Sharma TR, Shanker P, Singh BK, Jana TK, Madhav MS, Gaikwad K, Singh NK, Plaha P, Rathour R. 2005a. Molecular mapping of rice blast resistance gene Pi-kh in rice variety Tetep. Journal of Plant Biochemistry and Biotechnology 14, 127–133.
- ↑ 2.0 2.1 Costanzo S, Jia Y. 2010. Sequence variation at the rice blast resistance gene Pi-km locus: implications for the development of allele specific markers. Plant Science 178, 523–530.
- ↑ 3.0 3.1 Sana TR, Fischer S, Wholgemuth G, Kalrekar A, Jung K, Ronald PC, Fiehn O. 2010. Metabolomic and transcriptomic analysis of the rice response to the bacterial blight pathogen Xanthomonas oryzae pv. oryzae. Metabolomics 6, 451–465.
- ↑ 4.0 4.1 4.2 Kim S, Ahn IP, Park CH, Park SG, Park SY, Jwa NS, Lee YH. 2001. Molecular characterization of the cDNA encoding an acidic isoform of PR-1 protein in rice. Molecular Cells 11, 115–121.
- ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref5 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref6 - ↑ Cite error: Invalid
<ref>tag; no text was provided for refs namedref7