Os09g0449000

From RiceWiki
Revision as of 13:27, 23 May 2014 by Yuanjinhong13 (talk | contribs) (Mutation)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. PERSISTANT TAPETAL CELL1(PTC1), a key regulator in monocot rice (Oryza sativa), which controls programmed tapetal development and functional pollen formation. The evolutionary significance of PTC1was revealed by partial genetic complementation of the homologous mutation MALE STERILITY1(MS1) in the dicot Arabidopsis (Arabidopsis thaliana). PTC1 encodes a PHD-finger (for plant homeodomain) protein, which is expressed specifically in tapetal cells and microspores during anther development in stages 8 and 9, when the wild-type tapetal cells initiate a typical apoptosis-like cell death [1]. Even though ptc1 mutants show phenotypic similarity to ms1in a lack of tapetal DNA fragmentation, delayed tapetal degeneration, as well as abnormal pollen wall formation and aborted microspore development, the ptc1 mutant displays a previously unreported phenotype of uncontrolled tapetal proliferation and subsequent commencement of necrosis-like tapetal death. Moreover, the regulatory role of PTC1in anther development was revealed by comparison with MS1 and other rice anther developmental regulators. PTC1 may functions downstream of GAMYB[2], and in parallel with TDR in regulating programmed anther development and pollen formation[3]. P1.jpg

Mutation

Please input mutation information Compared with wild-type plants, ptc1 displayed complete male sterility and normal female development when tested by reciprocal cross analysis. All of the F1 progeny were fertile, with an approximate 3:1 ratio for phenotypic segregation in F2 plants (fertility:sterility = 189:55;x2=0.65), indicating that this mutation is due to a single recessive locus. ptc1 exhibited normal vegetative development (Fig. 2A). During the reproductive stage, ptc1 plants developed normal panicles and floral organs (Fig. 2, B–D), but ptc1 anthers were smaller, white, and lacked viable pollen grains (Fig. 2, D and E).

P2.jpg

From stage 9 (free microspore released from the tetrad) to early stage 10 (vacuolated microspore), ptc1 tapetal cells were more vacuolated than wild-type. From late stage 10 to stage 11 (mitosis I), ptc1 tapetum became abnormally enlarged, and cytosolic constituents seemed to be secreted into the anther locule. At stage 13, in the ptc1 anther, only cell debris of both tapetal cells and pollen grains remained. The ptc1 tapetum also appeared to have less accumulation of pollen wall precursor materials

P3.jpg

Expression

Please input expression information

According to the RiceGE (Gene Expression Atlas Data Sources), PTC1 expression is highest in the 10- to 15-cm inflorescence (stages 7–10), gradually decreasing in the 15- to 20-cm inflorescence (stages 10–12). Reverse transcription (RT)-PCR and quantitative RT-PCR (RT-qPCR) results indicated that PTC1was preferentially expressed in the anther from stage 8 to stage 9 (Fig. 4, A and B). Strikingly, ptc1 displayed an increased level of the mutantPTC1transcript (Fig. 4, A and B). This suggests either auto down-regulation of the PTC1 transcript or that the mutant transcript may be more stable and accumulates more than the wild type. In transgenic plants expressing the PTC1pro:GUS fusion (driven by the 3,043-bpPTC1upstream region), GUS staining was specifically detected in the anther from stages 8 to 9 and at a low level in stage 10 (Fig.4, C and D). No GUS expression was seen in the palea, lemma, pistil (Fig. 4, C and D) or other organs. Maximal GUS staining, albeit at a very low level, was seen in the tapetal tissues, but GUS was also apparent within the microspores (Fig. 4E), indicating that PTC1 plays a specific function in tapetal cells during anther development.


P4.jpg

Microarray analysis

Please input Microarray analysis here. Microarray analysis revealed 2,943 genes with a 2-fold or greater expression change over the two developmental stages in ptc1 anthers compared with the wild type (570 down-regulated and 278 up-regulated at stage 8; 1,252 down-regulated and 843 up-regulated at stage 9. The 2,417 genes can be group into four COG (for Cluster of Orthologous Groups of proteins) categories: I, information storage and processing (144 genes); II, cellular processes and signaling (363 genes); III, metabolism (551 genes); and IV, poorly characterized genes (1,359 genes)


P5.jpg

Evolution

Please input evolution information here.

You can also add sub-section(s) at will. To gain additional insights into the phylogenetic elationship between PTC1 and its close homologs, BLASTP searches were conducted with the full-length amino acid sequence of PTC1. An unrooted tree of PTC1 and its 25 homologs from moss to flowering plants was constructed. PTC1 was located in the same clade with Arabidopsis MS1.

P6.jpg

Labs working on this gene

Please input related labs here.

School of Life Sciences and Biotechnology and State Key Laboratory of Hybrid Rice, Shanghai Jiao Tong University, Shanghai,China

Plant Sciences Division, School of Biosciences, University of Nottingham, Loughborough, Leicstershire, United Kingdom

References

Please input cited references here.

[1] Hui Li, Zheng Yuan, Gema Vizcay-Barrena. et al.PERSISTENT TAPETAL CELL1 Encodes a PHD-Finger Protein That Is Required for Tapetal Cell Death and Pollen Development in Rice. Plant Physiology 156: 615–630 (2011)

[2] Aya K, Ueguchi-Tanaka M, Kondo M . et al. Gibberellin modulates anther development in rice via the transcriptional regulation of GAMYB. Plant Cell 21: 1453–1472 (2009)

[3] Li N, Zhang DS, Liu HS. et al. The rice tapetum degeneration retardation gene is required for tapetum degradation and anther development. Plant Cell 18: 2999–3014 (2006)

Structured Information

Gene Name

Os09g0449000

Description

Protein of unknown function UPF0054 family protein, P7.jpg

Version

NM_001069854.2 GI:297609560 GeneID:4347213

Length

2215 bp

Definition

Oryza sativa Japonica Group Os09g0449000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:17439752..17441966

Sequence Coding Region

17439752..17440061,17440136..17440442,17440544..17441966

Expression

GEO Profiles:Os09g0449000

Genome Context

<gbrowseImage1> name=NC_008402:17439752..17441966 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:17439752..17441966 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgcctaagatggtgatcagcctggggagctcgcggcggcggaagcgcggcgagatgctgttccggttcgaggccttctgccagcccggctacccggcgaacttcgccggcgccggcggcttcagggacaacgtgaggacgctgctcggcttcgcgcacctggaggccggcgtccacggcgagaccaagtgctggtcgttccagctcgagctgcaccgccacccccccaccgtcgtgaggctcttcgtcgtcgaggaggaggtcgccgcctcgccgcaccgccagtgccacctctgccgccatattgggtgggggaggcatctgatatgcagcaagaggtatcacttcttgctgccgaggagggaatcggcggcggaagccgacggcctgtgcttcgcgatcaaccacggcggcggcggtggcgcggagaaagcgtcgtcgaaagggacgacgacgacggcctccagcagaggccacctgctacacggcgtcgtgcacctcaacggctacggccacctcgtcgccctccacggcctcgagggcggctccgacttcgtctccggccaccagatcatggacctctgggaccgcatttgctcagccttgcacgtaaggacggtgagcctggtggacacggcgaggaagggccacatggagctgaggctgctgcacggcgtcgcgtacggcgagacgtggttcgggcggtgggggtacaggtacggccggccgagctacggcgtcgcgctgccgtcgtaccggcagtcgctgcacgtgctcggctccatgccgctctgcgtgctggtgccgcacctgtcgtgcttcagccaggagctccccatggtggtcaccaagtaccaggccatcagcggccacaagctgctcagcctcggcgacctcctccgcttcatgctcgagctgcgcgcccgcctgccggccacctccgtcacggccatggactaccggggcatcatgtcggaggcctcgtgccggtggtcggcgaagcgcgtcgacatggcggcgcgcgccgtcgtggacgcgctccgccgcgccgagccggcggcgcggtgggtcacgcggcaggaggtgcgcgacgcggcgcgcgcctacatcggcgacacgggcctcctcgacttcgtgctcaagtccctcggcaaccacatcgtcggcaactacgtcgtgcgccgcaccatgaacccggtgaccaaggtgctcgagtactgcctcgaggacgtctccagcgtgctcccggcggtcgccgccggcggcggcgtgccggcgcagggcaagatgagggtgaggttccagctcacgcgtgcgcagctcatgagggacctggtgcacctgtaccggcacgtgctcaaggagcccagccaggcgctcaccggcggcgcgttcggcgcgatcccggtggcggtgcggatggtcctggacatcaagcacttcgtcaaagattaccacgaaggacaagccgcggcgagcagcaatggcggtggcggattcgggcatccccacatcaacctgtgctgcacgctgctcgtgagcaacgggagcccggagctagctccaccgtacgagacggtgaccctgccggcgcacgcgacggtgggcgagctgaagtgggaggcgcagagggtgttcagcgagatgtacctcggcctgaggagcttcgcggcggactccgtcgtcggggtcggcgccgaccaggagggcctcccggtgctcgggctggtcgacgtcggaagcgccgtcgtggtgcaagggagcgtgggcgagcagataaacggggaggaccacgagaggaaggaggaggcggcggcggcggccgtgtgcgaggggagcggcggcggcgagcgcgtcgtggactgcgcgtgcggcgcggtggacgacgacggcgagcgcatggcgtgctgcgacatctgcgaggcgtggcagcacacgcggtgcgccgggatcgcggacaccgaggacgcgccgcacgtcttcctctgcagccggtgcgacaacgacgtcgtgtcgttcccgtccttcaactgttag</cdnaseq>

Protein Sequence

<aaseq>MAPKMVISLGSSRRRKRGEMLFRFEAFCQPGYPANFAGAGGFRD NVRTLLGFAHLEAGVHGETKCWSFQLELHRHPPTVVRLFVVEEEVAASPHRQCHLCRH IGWGRHLICSKRYHFLLPRRESAAEADGLCFAINHGGGGGAEKASSKGTTTTASSRGH LLHGVVHLNGYGHLVALHGLEGGSDFVSGHQIMDLWDRICSALHVRTVSLVDTARKGH MELRLLHGVAYGETWFGRWGYRYGRPSYGVALPSYRQSLHVLGSMPLCVLVPHLSCFS QELPMVVTKYQAISGHKLLSLGDLLRFMLELRARLPATSVTAMDYRGIMSEASCRWSA KRVDMAARAVVDALRRAEPAARWVTRQEVRDAARAYIGDTGLLDFVLKSLGNHIVGNY VVRRTMNPVTKVLEYCLEDVSSVLPAVAAGGGVPAQGKMRVRFQLTRAQLMRDLVHLY RHVLKEPSQALTGGAFGAIPVAVRMVLDIKHFVKDYHEGQAAASSNGGGGFGHPHINL CCTLLVSNGSPELAPPYETVTLPAHATVGELKWEAQRVFSEMYLGLRSFAADSVVGVG ADQEGLPVLGLVDVGSAVVVQGSVGEQINGEDHERKEEAAAAAVCEGSGGGERVVDCA CGAVDDDGERMACCDICEAWQHTRCAGIADTEDAPHVFLCSRCDNDVVSFPSFNC</aaseq>

Gene Sequence

<dnaseqindica>1..310#385..691#793..2215#atggcgcctaagatggtgatcagcctggggagctcgcggcggcggaagcgcggcgagatgctgttccggttcgaggccttctgccagcccggctacccggcgaacttcgccggcgccggcggcttcagggacaacgtgaggacgctgctcggcttcgcgcacctggaggccggcgtccacggcgagaccaagtgctggtcgttccagctcgagctgcaccgccacccccccaccgtcgtgaggctcttcgtcgtcgaggaggaggtcgccgcctcgccgcaccgccagtgccacctctgccgccatattggtccgtcgaacaaactacaattaatcaatcaacctttacataggattgatccgatcgatgccatggtgttgtagggtgggggaggcatctgatatgcagcaagaggtatcacttcttgctgccgaggagggaatcggcggcggaagccgacggcctgtgcttcgcgatcaaccacggcggcggcggtggcgcggagaaagcgtcgtcgaaagggacgacgacgacggcctccagcagaggccacctgctacacggcgtcgtgcacctcaacggctacggccacctcgtcgccctccacggcctcgagggcggctccgacttcgtctccggccaccagatcatggacctctgggaccgcatttgctcagccttgcacgtaaggtagtagtagtatacatgtgcgtgtgcatgcatgcaagcaatgcaacgatgtcgggctgcgtgtgagaacatttgcttgggcatggtgtggtgtatgcaaggacggtgagcctggtggacacggcgaggaagggccacatggagctgaggctgctgcacggcgtcgcgtacggcgagacgtggttcgggcggtgggggtacaggtacggccggccgagctacggcgtcgcgctgccgtcgtaccggcagtcgctgcacgtgctcggctccatgccgctctgcgtgctggtgccgcacctgtcgtgcttcagccaggagctccccatggtggtcaccaagtaccaggccatcagcggccacaagctgctcagcctcggcgacctcctccgcttcatgctcgagctgcgcgcccgcctgccggccacctccgtcacggccatggactaccggggcatcatgtcggaggcctcgtgccggtggtcggcgaagcgcgtcgacatggcggcgcgcgccgtcgtggacgcgctccgccgcgccgagccggcggcgcggtgggtcacgcggcaggaggtgcgcgacgcggcgcgcgcctacatcggcgacacgggcctcctcgacttcgtgctcaagtccctcggcaaccacatcgtcggcaactacgtcgtgcgccgcaccatgaacccggtgaccaaggtgctcgagtactgcctcgaggacgtctccagcgtgctcccggcggtcgccgccggcggcggcgtgccggcgcagggcaagatgagggtgaggttccagctcacgcgtgcgcagctcatgagggacctggtgcacctgtaccggcacgtgctcaaggagcccagccaggcgctcaccggcggcgcgttcggcgcgatcccggtggcggtgcggatggtcctggacatcaagcacttcgtcaaagattaccacgaaggacaagccgcggcgagcagcaatggcggtggcggattcgggcatccccacatcaacctgtgctgcacgctgctcgtgagcaacgggagcccggagctagctccaccgtacgagacggtgaccctgccggcgcacgcgacggtgggcgagctgaagtgggaggcgcagagggtgttcagcgagatgtacctcggcctgaggagcttcgcggcggactccgtcgtcggggtcggcgccgaccaggagggcctcccggtgctcgggctggtcgacgtcggaagcgccgtcgtggtgcaagggagcgtgggcgagcagataaacggggaggaccacgagaggaaggaggaggcggcggcggcggccgtgtgcgaggggagcggcggcggcgagcgcgtcgtggactgcgcgtgcggcgcggtggacgacgacggcgagcgcatggcgtgctgcgacatctgcgaggcgtggcagcacacgcggtgcgccgggatcgcggacaccgaggacgcgccgcacgtcttcctctgcagccggtgcgacaacgacgtcgtgtcgttcccgtccttcaactgttag</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0449000, RefSeq:Os09g0449000