Os07g0694700

From RiceWiki
Revision as of 14:17, 23 May 2014 by Lwt818 (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

RNA gel blot analysis showed that the transcription of the OsAPx2 gene increased significantly with time of exposure to NaCl, NaHCO3, and PEG 6000[1].

Expression

RNA gel blot analysis showed that the transcription of the OsAPx2 gene increased significantly with time of exposure to NaCl, NaHCO3, and PEG 6000[1]. APX isozymes occur in several cell compartments and occur in many plants, including Arabidopsis, spinach, pumpkin, tobacco, soybean, potato and rice. Plant APX isoforms act differently in response to stress and in different developmental stages[2]. rice plants that overexpress OsAPXa and have increased APX activity. The effect of increased APX activity on the levels of H(2)O(2) and lipid peroxidation were determined by measuring H(2)O(2) levels and malondialdehyde (MDA) contents in spikelets during cold treatments at the booting stage. The levels of H(2)O(2) and the MDA content increased by 1.5-fold and twofold, respectively in WT plants subjected to a 12 °C treatment for 6 days. In contrast, transgenic lines showed small changes in H(2)O(2) levels and MDA content under cold stress, and H(2)O(2) levels and MDA content were significantly lower than in WT plants. APX activity showed negative correlations with levels of H(2)O(2) and MDA content, which increased during cold treatment. Cold tolerance at the booting stage in transgenic lines and WT plants was evaluated. Spikelet fertility was significantly higher in transgenic lines than in WT plants after a 12 °C treatment for 6 days. These results indicate that higher APX activity enhances H(2)O(2)-scavenging capacity and protects spikelets from lipid peroxidation, thereby increasing spikelet fertility under cold stress[3].

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0694700

Description

L-ascorbate peroxidase

Version

NM_001067276.1 GI:115474284 GeneID:4344397

Length

2553 bp

Definition

Oryza sativa Japonica Group Os07g0694700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:30243906..30246458

Sequence Coding Region

30244470..30244485,30244580..30244638,30244773..30244875,30244992..30245071,30245161..30245246
,30245605..30245653,30245846..30245911,30245997..30246171,30246265..30246386

Expression

GEO Profiles:Os07g0694700

Genome Context

<gbrowseImage1> name=NC_008400:30243906..30246458 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:30243906..30246458 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgggcagcaagtcgtacccgacggtgagcgatgagtacctggcggccgtgggcaaggcgaagcgcaagctccgcggcctcatcgccgagaagaactgcgccccactcatgctccgcctcgcgtggcactctgctggcaccttcgatgtgtcgtcgaggaccggcgggcccttcggcaccatgaagaaccccggcgagcagtcccacgccgccaacgccggcctcgacatcgccgtcaggcttctcgaccccatcaaggaccaacttcccatcctctcctacgccgacttctaccagcttgctggcgttgtggccgtcgaggtcaccggcggacctgaggtccccttccatccgggcaggcaggacaagcctgagcctcctcctgaaggccgtcttcctgatgccacacaaggttctgaccacctaaggcaggtcttttctgcgcagatgggtttgagtgacaaggacatagttgctctttctggtggtcacaccctgggaagatgccacaaggagagatctggctttgagggagcctggacgtccaaccctttgatctttgacaactcttacttcaccgagcttgtgagtggcgagaaggaaggccttcttcagctgccaagtgacaaagccctcatggctgacccagccttccgtccactggtggagaaatatgctgcggatgaggacgccttctttgcggattacgccgaggcccacctcaagctctctgaactgggatttgctgaggaataa</cdnaseq>

Protein Sequence

<aaseq>MGSKSYPTVSDEYLAAVGKAKRKLRGLIAEKNCAPLMLRLAWHS AGTFDVSSRTGGPFGTMKNPGEQSHAANAGLDIAVRLLDPIKDQLPILSYADFYQLAG VVAVEVTGGPEVPFHPGRQDKPEPPPEGRLPDATQGSDHLRQVFSAQMGLSDKDIVAL SGGHTLGRCHKERSGFEGAWTSNPLIFDNSYFTELVSGEKEGLLQLPSDKALMADPAF RPLVEKYAADEDAFFADYAEAHLKLSELGFAEE</aaseq>

Gene Sequence

<dnaseqindica>1974..1989#1821..1879#1584..1686#1388..1467#1213..1298#806..854#548..613#288..462#73..194#ggtgaggtgaggtgagttgagttggggattgattgattgattcggattgggaagaagaagaagcaggggagcatgggcagcaagtcgtacccgacggtgagcgatgagtacctggcggccgtgggcaaggcgaagcgcaagctccgcggcctcatcgccgagaagaactgcgccccactcatgctccgcctcgcgtaactttcttcttcttcttcttctactgattaatttccagaagatagagtaggaggagtagatgttgaattgcagtggctggctggctgcaggtggcactctgctggcaccttcgatgtgtcgtcgaggaccggcgggcccttcggcaccatgaagaaccccggcgagcagtcccacgccgccaacgccggcctcgacatcgccgtcaggcttctcgaccccatcaaggaccaacttcccatcctctcctacgccgacttctaccaggtaaggttcacttccctcccttcctcccttccttcctctcaactcatcaacctcttaattggagtctctccctctctattggcagcttgctggcgttgtggccgtcgaggtcaccggcggacctgaggtccccttccatccgggcaggcaggtcagaatcacatttcccatccctaaaccctctccctctctctccccccttcttctttcttcttctggtagatgcaaatggtatttttcttaagtcaattcttttctttcgtcatcttgtacgccgctgtttcctttccctgaattctccactgtcttgtgaatgttgatgatgtgatgtgtttgtttctaggacaagcctgagcctcctcctgaaggccgtcttcctgatgccacacaaggtattaagatttcctctgtattaagttacccctatgacaatgcatttcccaatgtgttggtgattaaattttctagatctatgaccagcatttgtatgtgctactgatggagtagttcatattgcaagtccattaccagaattctttcatgcttaagtaagttgtgtaacctacataagactaaaattttccaaccctgtttatgcaaaccacattactaaagtttgttttgtgttcctgtttattcttctttcttatatggagcatacatgttacctgtgtgttctttaattaacagtgtgccaatttgtggatgcgagataactaatatgtcatggtcttctggctgttggtccaggttctgaccacctaaggcaggtcttttctgcgcagatgggtttgagtgacaaggacatagttgctctttctggtggtcacaccctggttggtacacttgtgcaattgccctagtgtgtttctcatatcttgtaaccggaagggttattcatgcagcttcacttcatcttctgtagggaagatgccacaaggagagatctggctttgagggagcctggacgtccaaccctttgatctttgacaactcttacttcacgtgcgtgatctctgattctttttaaagatgcatcctgtctgttgataaacagccagccacagcttgtttccttgtatgctaaagaatgaaaaccaaaatctcctctcgatcaacagcgagcttgtgagtggcgagaaggaaggccttcttcagctgccaagtgacaaagccctcatggctgacccagccttccgtccactggtggagaaatatgctgcggtacaccccttgatccttgcattattttctctcgtcttctttctaaagagttgttttttttaaaataaaagaaataagagaaatggatcatcgttgatctcttaaaaagtagatgattgttgcctgatatgtaggatgaggacgccttctttgcggattacgccgaggcccacctcaagctctctgaactggggtaagggatgcaactggtgtgcttgtctgtgatgcgttattggagtgctttgtgccagagtttcactaattattgttgtgtttgtgggtttcagatttgctgaggaataagaagcctttagagagcgggatatccgcaaaagattaatgccgatttgtattttgcgccttagagtcagtacgatcaagactgtcgtggcggttgtaataaaaattagtgtgctttgggccatctttttatgtgattccaattgtctttctcttcattcttgctttgatgctctttgtctggacctctagaccgccgtattgtactgtggagtttcaaagttaccaagctatttgctgtcaagataactatggattgaattccccttgatggatgaaccaactgttgttgtttgcccgttcttcagctttcgtttgtgcggccatcgatcgccatgcgttgcttaaacccatttctagctcccctaccctgctgcatccgccctcttctgcgcgatcgttggattgcgagtggttggctggttgcacgacttgtggagaccgaaacaaataatttttggtcaaattgatcggtggtactgtcggagcatctattttttctttagcttagatcgtataattgtaggattgggatttgtatattaatatatacaggtcgattaaaac</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0694700, RefSeq:Os07g0694700