Os11g0126900

From RiceWiki
Revision as of 02:03, 24 May 2014 by Yingyingbei (talk | contribs) (Knowledge Extension)
Jump to: navigation, search

Please input one-sentence summary here.

The rice Os11g0126900 was reported as NAC (an acronym for NAM [No Apical Meristem], ATAF1-2, and CUC2 [Cup-Shaped Cotyledon]) domain gene, OsNAC10,in 2010 by Korean researchers.

Annotated Information

Function

OsNAC10 plays important role in enhancing stress tolerance when overexpressed in rice. In Jeong, J. S's et al. research, they constructed two types of transgenic plants,RCc3:OsNAC10, GOS2:OsNAC10.A phenotype evaluation of RCc3:OsNAC10, GOS2:OsNAC10 and NTcontrol plants revealed no major differences at the vegetative growth stage of the entire plant.Under normal conditions, the grain yield of the GOS2:OsNAC10 plants remains similar to that of the NT controls. Filling rate and 1000 grain weight of the GOS2:OsNAC10 plants were markedly reduced and the reduction appeared to be balanced by the increase in numbers of panicles and total spikelets. While under the same conditions, RCc3:OsNAC10 plants’ total grain weight was increased by 5% to 14% compared with the NT controls, which was due to increased numbers of filled grains and total spikelets. Under drought conditions, RCc3:OsNAC10 plants’ total grain weight increased 25% to 42% compared with NT controls. In contrast, GOS2:OsNAC10 plants remain similar total grain weight with NT controls under drought condition.[1]

Expression

  • OsNAC10 is expressed predominantly in roots and panicles[1] (finger 1 A).
    Figure 1.Expression analyses of OsNAC10(from reference [1]).
  • The expression of OsNAC10 is induced by drought, high salinity, and ABA but not by low temperature[1].(finger 1 B)
  • 34 root-specific and 40 leaf-specific target genes were up-regulated when OsNAC10 was overexpressed in transgenic plants.Transcript levels of seven root-specific target genes [P450, Zn-finger, HAK5, 2OG-Fe(Ⅱ),NCED, NAC, and KUP3] were increased in transgenic roots. Expression of two leaf-specific target genes, LRR and Peroxidase, was found to be OsNAC10 dependent only in GOS2:OsNAC10 leaves but not in RCc3:OsNAC10 leaves. Expression of two common target genes, F-box and Muts4, was found to be OsNAC10 dependent both in roots and leaves of the GOS2:OsNAC10 plants[1].

Evolution

According to the phylogenic analysis of the amino acid sequences of 18 OsNAC proteins, OsNAC10 is in the subgroup Ⅰ(finger 2)[1].
Figure 2. Identification of stress-inducible rice NAC domain genes(from reference [1]).

Knowledge Extension

File:1-s2.0-S1360138512000428-gr1.jpg
NAC's structure and regulation pathway (from reference [2]).
  • Name of NAC. It derives from the three genes first described as containing the domain, no apical meristem (NAM) gene of Petunia [3] and the ATAF1, ATAF2 and CUC (cup-shaped cotyledon) genes of Arabidopsis [4].
  • Structure of NAC. NAC proteins share a well conserved N-terminal NAC domain (∼150 amino acids; aa) and a diversified C-terminal transcription regulatory (TR) region

You can also add sub-section(s) at will.

Labs working on this gene

  • School of Biotechnology and Environmental Engineering, Myongji University, Yongin 449-728, Korea.
  • National Academy of Agricultural Science, Suwon 441–707, Korea.
  • School of Agricultural Biotechnology, Seoul National University, Seoul 151–921, Korea.
  • CropDesign NV, B–9052 Ghent, Belgium

References

<references> [1] [3] [4] [2]

Structured Information

Gene Name

Os11g0126900

Description

Similar to NAC domain transcription factor

Version

NM_001072159.1 GI:115483930 GeneID:4349648

Length

2046 bp

Definition

Oryza sativa Japonica Group Os11g0126900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:1215803..1217848

Sequence Coding Region

1216006..1216177,1216305..1216612,1216879..1216914

Expression

GEO Profiles:Os11g0126900

Genome Context

<gbrowseImage1> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:1215803..1217848 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgaggaatccacaagaagagcaacgacttcaattcctctga</cdnaseq>

Protein Sequence

<aaseq>MPSSGGAMPALPPGFRFHPTDEELIVHYLMNQAASVKCPVPIIA EVNIYKCNPWDLPGKALFGENEWYFFSPRDRKYPNGARPNRAAGSGYWKATGTDKSIL STPTSDNIGVKKALVFYKGKPPKGVKTDWIMHEYRLTGTSANSTTTTKQRRASSMTMR NPQEEQRLQFL</aaseq>

Gene Sequence

<dnaseqindica>204..375#503..810#1077..1112#atttcaatccttcctcttccttagcttattagcttccttccttcactagtgccagttttcctcctacctaatctaagctagccaggtcgtcatcttcttccttcagctcacgctgaccaaacaccatctgttattctgtttgtttgtttttttaaaaaaaagaaaaaaaatctagctaggcgagccgattgaaggagctgagcatgccgagcagcggcggcgccatgcctgcccttccaccaggcttccgcttccaccccaccgacgaggagctcatcgttcactacctcatgaaccaggccgcctccgtcaagtgccccgtgccaatcatcgccgaggtcaacatctacaagtgcaacccatgggaccttcctggtaactaactaactaatcaccatacatatatatactatccatgtatcaattaaactcgatcaaattaatgccttcaaactgaccaaatttaactttgggctttgaaaatggatatgggatgttgcaggtaaggctttgttcggcgagaacgaatggtacttcttcagcccgagggaccgcaagtaccccaacggcgctcgccccaaccgcgccgccggctcggggtactggaaggccaccggcaccgacaagtccatcctctccactccgaccagcgacaacatcggcgtcaagaaggccctcgtcttctacaagggcaagcctcccaagggcgtcaagaccgactggatcatgcacgagtaccgtctcaccggcacatcagctaacagcaccaccaccacaaagcagcgtagagcgtcatccatgaccatgagggtgagattaattacttaactaatttagttttctcttcgtcgtacgtcttgtttgaaagctacttgttgtttggcataaagaaggagcaacgtgcatgttgctcttagttaactcagtacaaagtcaaatgagttgatgttgattgagcttgttttattcttggtatatattttattttttagaaaagggttaaagtttgcacgcttctaattattgtttactgcatttgtgattgtccatcagctggacgactgggtgctgtgcagaatccacaagaagagcaacgacttcaattcctctgaccaacacgaccaagaacccgaggaatcaaccgtcgaacagcttgaagacatccatgacaacaactcctctgaacaacctccagctccagctgacatgaacaaccaacagtcagatttccagcccatgacggcgatgagcatgagcaagtcatgctccctcaccgatctcctcaacaccatcgactgcgccgcgctctcgcagtttctcctcgacggctcatccgacgccatcgctgagcctcctgctcctcccagccccctaatatacacaacacctcatccaaattaccaaacactaaactataacattaacagcaacagcagcatgccacacgccttcgagtcacgcctagatcatcacgatggttacgttaacaattataatgttaatggcctgaggaggaagagaatgatggcgtgtagtgcaacttcctttgatgatggcagcagcagcaatgactttgtgcatgccgttgtcaagaaaccgcagctgctgccaagtgattcgaggggtagtggttttggaggaggttactgcaaccagcagctttcagagactgcgactggctttcagtttcagaacggcaatctgctgagccatccatttcctctgaacaatcatctgcagatgcagtagtaggcgtctagatcccgtttaccgatcgatctgaagagaggtgaattaatttcaacgaatgaaactacagattcagagaggaagatactgattgttccatttgtgatttattttgaggagttgcatgggcagatagacaaacagacggaattcttgatgtaaccgatgcaaggaaagattcagatttcttcctatggcattaatttgtgagtttttttttgttttcattttcatgtacaagaatgtaaattataaatggtaatatcgtgcaagctagtactcaagccaatttatatg</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0126900, RefSeq:Os11g0126900

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Jeong, J. S., Kim, Y. S.,Baek, K. H.,et al. (2010). "Root-specific expression of OsNAC10 improves drought tolerance and grain yield in rice under field drought conditions." Plant Physiol 153(1): 185-197.
  2. 2.0 2.1 Puranik, S.,Sahu, PP. Srivastava,PS.,et al. (2012). "NAC proteins: regulation and role in stress tolerance." Trends Plant Sci 17(6): 369-381.
  3. 3.0 3.1 Souer E, van Houwelingen A, Kloos D,et al. (1996)."The no apical meristem gene of Petunia is required for pattern formation in embryos and flowers and is expressed at meristem and primordia boundaries."Cell 85(2):159–170
  4. 4.0 4.1 Aida M, Ishida T, Fukaki H,et al. (1997)."Genes involved in organ separation in Arabidopsis: an analysis of the cup-shaped cotyledon mutant." Plant Cell 9(6):841–857