Os08g0114200

From RiceWiki
Revision as of 03:37, 25 May 2014 by Libaolian (talk | contribs) (Expression)
Jump to: navigation, search

The rice Os08g0114200 is OsGLU3 which is similar to CEL5=CELLULASE 5 coding a β-1,4-endoglucanase,playing an significant role in root elongation in rice

Annotated Information

Function

The gene OsGLU3 (Os08g0114200), a β-1,4-endoglucanase, can affect the cellulose synthesis for root elongation in rice. And the phosphate starvation induced root elongation in rice depends on the function of OsGLU3 (Os08g0114200). Which was researched that OsGLU3 (Os08g0114200) is also dispensable for nitrogen starvation induced root elongation in rice. The test:The Wild type (WT, SSBM) were grown for 10 d in media without nitrogen and transferred to low nitrogen media (2 mg/L nitrogen) or control media (40 mg/L nitrogen) for another 20d respectively. The nitrogen starvation stress leads to an around 20% increase of primary root elongation in WT as compared with that grown under the control condition, Figure 1A). It showed that nitrogen starvation can lead to an increase of approximately 13% in rice root cell elongation (Fig. 1C and E).It also found that the nitrogen starvation can lead to an approximately 15% increase in root cellulose content (Fig. 1D). It was identified phosphate starvation and the nitrogen starvation stimulate primary root elongation by inducing root cell elongation and activating root mitotic activity.it suggests that nitrogen starvation induced primary root elongation depends on the activity of OsGLU3 (Os08g0114200).An OsGLU3(Os08g0114200) dependant way affect root cell wall cellulose synthesis by modulating root architectureboth in the phosphate or nitrogen starvation in rice.OsGLU3 (Os08g0114200)is a key player in the carbon partitioning system, as loss of function of it can abolish the response.(1) The fully functional OsGLU3–GFP was detected in plasma membrane, and FM4-64-labeled compartments in the root meristem and elongation zones.(3)

Mutation

Screeningan ethylmethane sulfonate (EMS)-mutagenized rice library, and isolated a short root mutant,Osglu3-1. The map-based cloning results showed that the mutant was due to a point mutation inOsGLU3, which encodes a putative membrane-bound endo-1,4-b-glucanase. Osglu3-1displayed less crystalline cellulose content in its root cell wall, shorter root cell length, and a slightly smaller root meristem as visualized by restricted expression ofOsCYCB1,1:GUS. Exogenous application of glucose can suppress both the lower root cell wall cellulose content and short root phenotypes ofOsglu3-1.The mutant resulted from a mutation in a rice KOR1 homologOsGLU3, which encodes a putative membranebound endo-1,4-b-glucanase. OsGLU3 can affect root cell wall cellulose synthesis to modulate root elongation. Phosphate starvation, an environmental stress,can modulate root cell wall cellulose synthesis to induce root growth in an OsGLU3-dependent way. the cell length of mature epidermal cells was only one-third of those in the WT, while the root hair length of the mutant is similar to that of WT (Figure 2B and 2C ).The region expressing the OsCYCB1,1:GUSin the root meristem of mutant is about 90% of that in WT (Figure 1D and 1E). Together,these data suggest that the short root phenotype ofOsglu3-1results from defects in both root cell elongation and division,particularly defect in cell elongation.(3)

Expression

In the rice genome, endo-1,4-b-D-glucanases form a multiple gene family including OsGLU3 which share high sequence similarity with KOR1. (2)OsGLU3is ubiquitously expressed in various tissues with strong expression in root tip, lateral root, and crown root primodia.OsGLU3contains four exons and three introns (Figure 2B). The putative OsGLU3 was predicted to contain a transmembrane domain, a cytosolic domain, and a catalytic domain (Supplemental Figure 3A). The mutation is located in the catalytic domain, which is highly conserved among the plant KOR1 homologs (Supplemental Figure 3)(3)

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1. Zhang J, Xu L, Wang F, Deng M, Yi K. Modulating the root elongation by phosphate/nitrogen starvation in an OsGLU3 dependant way in rice. Plant signaling & behavior. 2012;7(9):1144-5. 2. Zhou HL, He SJ, Cao YR, Chen T, Du BX, Chu CC, et al. OsGLU1, a putative membrane-bound endo-1,4-beta-D-glucanase from rice, affects plant internode elongation. Plant molecular biology. 2006;60(1):137-51. 3. Zhang JW, Xu L, Wu YR, Chen XA, Liu Y, Zhu SH, et al. OsGLU3, a putative membrane-bound endo-1,4-beta-glucanase, is required for root cell elongation and division in rice (Oryza sativa L.). Mol Plant. 2012;5(1):176-86.

Structured Information

Gene Name

Os08g0114200

Description

Similar to CEL5=CELLULASE 5 (Fragment)

Version

NM_001067383.1 GI:115474502 GeneID:4344508

Length

1867 bp

Definition

Oryza sativa Japonica Group Os08g0114200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:762215..764081

Sequence Coding Region

762288..762572,762658..763944

Expression

GEO Profiles:Os08g0114200

Genome Context

<gbrowseImage1> name=NC_008401:762215..764081 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:762215..764081 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtgcagttggtcactctcgagccacactctcacttcgccggtgaggcaggcagcaatggagccaaagagcagcagctgcggcggcgccggcattcggctgcggctgctggtcgtgctccacctgctgctcttagttccgagctcggccatggcgttcaactacgccgacgcgctcgccaagtccatcatcttcttcgagggccagcgctccggcaagctcccgcccggcaaccgcatgccgtggcgcgccgactccggcctcaccgacggcgcccagtacaatgtggatttggtgggcgggtactacgacgccggcgacaacgtcaagttcggcctgcccatggcgttctcgacgacgatgctggcgtggagcgtgctcgacttcggcaagttcatgggcgccgagctgcccaacgcccgcgccgccgtgcgctggggcgccgactacctcctcaaggccgccaccgccacgcccggcgcgctctacgtccaggtcgccgaccccaaccaggaccaccgctgctgggagcgccccgaggacatggacacaccccgcagcgtctaccgcgtcaccgccgacaagccgggttccgacgtcgccggcgagacggccgccgcgctcgccgcgtcgtccatggtgttccgccgcgccgacccggcctactccgcgcgcctcctccacgccgcgacgcaggtgttcgacttcgccgaccggcaccgcgggtcgtacagcgactcgctggcgtcgtcggtgtgcccgttctactgctcctactcgggctaccacgacgagctcctgtggggggcgtcgtggctgcaccgcgcgtcgaggaacgcgtcgttcatgtcgtacgtggaggcgaacgggatgcagctcggcgccggggacgacgactactccttcagctgggacgacaagcgggtgggcaccaaggtgctcctcgccaagggcttcctccgcaaccgcctccatggcctcgagctctacaaggcgcactccgacagctacatctgctcgctggtgcccggcacggcgagcttccagtcgcggtacacccccggcggcctcctgtacagggaaggctccagcaacatgcagtacgtgacgacggcgacgttcctgatgctggcgtacgccaagtacctccggtcgagcggcgccaccgcgtcgtgcggcgacggcggcggcggagcgaggggggaggtgtcggcggcggagctggtggcggtggcgaagcggcaggtggactacatcctggggaagaacccggcggggatgtcgtacatggtggggttcgggtgcaggtacccgaggcgggcgcaccaccgcggcgcgtccatgccgtcggtgcgcgcccacccggggcggatctcctgcgacgccggcttcggctacctccactccggcgagcccaacccgaacgtgctcgtcggcgccgtcgtcggcgggccggacagccgcgacgcctttgccgacgaccgcggcaacttcgcgcagtcggagccggccacctacatcaacgcgccgctcgtcggcgcgctcgcctacttcgccggaaccaccaagtag</cdnaseq>

Protein Sequence

<aaseq>MCSWSLSSHTLTSPVRQAAMEPKSSSCGGAGIRLRLLVVLHLLL LVPSSAMAFNYADALAKSIIFFEGQRSGKLPPGNRMPWRADSGLTDGAQYNVDLVGGY YDAGDNVKFGLPMAFSTTMLAWSVLDFGKFMGAELPNARAAVRWGADYLLKAATATPG ALYVQVADPNQDHRCWERPEDMDTPRSVYRVTADKPGSDVAGETAAALAASSMVFRRA DPAYSARLLHAATQVFDFADRHRGSYSDSLASSVCPFYCSYSGYHDELLWGASWLHRA SRNASFMSYVEANGMQLGAGDDDYSFSWDDKRVGTKVLLAKGFLRNRLHGLELYKAHS DSYICSLVPGTASFQSRYTPGGLLYREGSSNMQYVTTATFLMLAYAKYLRSSGATASC GDGGGGARGEVSAAELVAVAKRQVDYILGKNPAGMSYMVGFGCRYPRRAHHRGASMPS VRAHPGRISCDAGFGYLHSGEPNPNVLVGAVVGGPDSRDAFADDRGNFAQSEPATYIN APLVGALAYFAGTTK</aaseq>

Gene Sequence

<dnaseqindica>74..358#444..1730#agcaaattgatatactactccagcaccggccaaattaactaacttaacggccactgcttttcacactatattaatgtgcagttggtcactctcgagccacactctcacttcgccggtgaggcaggcagcaatggagccaaagagcagcagctgcggcggcgccggcattcggctgcggctgctggtcgtgctccacctgctgctcttagttccgagctcggccatggcgttcaactacgccgacgcgctcgccaagtccatcatcttcttcgagggccagcgctccggcaagctcccgcccggcaaccgcatgccgtggcgcgccgactccggcctcaccgacggcgcccagtacaatgtacgtacgccgcctctctctctttccctttcttccttgtctccggcgaggaggagtttgtgattccggcgtgtttgtgtttcaggtggatttggtgggcgggtactacgacgccggcgacaacgtcaagttcggcctgcccatggcgttctcgacgacgatgctggcgtggagcgtgctcgacttcggcaagttcatgggcgccgagctgcccaacgcccgcgccgccgtgcgctggggcgccgactacctcctcaaggccgccaccgccacgcccggcgcgctctacgtccaggtcgccgaccccaaccaggaccaccgctgctgggagcgccccgaggacatggacacaccccgcagcgtctaccgcgtcaccgccgacaagccgggttccgacgtcgccggcgagacggccgccgcgctcgccgcgtcgtccatggtgttccgccgcgccgacccggcctactccgcgcgcctcctccacgccgcgacgcaggtgttcgacttcgccgaccggcaccgcgggtcgtacagcgactcgctggcgtcgtcggtgtgcccgttctactgctcctactcgggctaccacgacgagctcctgtggggggcgtcgtggctgcaccgcgcgtcgaggaacgcgtcgttcatgtcgtacgtggaggcgaacgggatgcagctcggcgccggggacgacgactactccttcagctgggacgacaagcgggtgggcaccaaggtgctcctcgccaagggcttcctccgcaaccgcctccatggcctcgagctctacaaggcgcactccgacagctacatctgctcgctggtgcccggcacggcgagcttccagtcgcggtacacccccggcggcctcctgtacagggaaggctccagcaacatgcagtacgtgacgacggcgacgttcctgatgctggcgtacgccaagtacctccggtcgagcggcgccaccgcgtcgtgcggcgacggcggcggcggagcgaggggggaggtgtcggcggcggagctggtggcggtggcgaagcggcaggtggactacatcctggggaagaacccggcggggatgtcgtacatggtggggttcgggtgcaggtacccgaggcgggcgcaccaccgcggcgcgtccatgccgtcggtgcgcgcccacccggggcggatctcctgcgacgccggcttcggctacctccactccggcgagcccaacccgaacgtgctcgtcggcgccgtcgtcggcgggccggacagccgcgacgcctttgccgacgaccgcggcaacttcgcgcagtcggagccggccacctacatcaacgcgccgctcgtcggcgcgctcgcctacttcgccggaaccaccaagtagccattagtgagagtgtgagtgacgtggcagtgtgggagcgcgaggccagtgagatgagctcccccgccacgctgtatcgttcgttgactttgtcgtgtattcgacgcaacaaacagtatttgcacggagtacgtacg</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0114200, RefSeq:Os08g0114200