Os01g0797600
Please input one-sentence summary here.
Contents
Annotated Information
Function
- OsERF3 (Os01g0797600), is AP2 domain-containing protein, it is found to be significantly up-regulated in both genotypes under cold stress.[1]
- OsERF3 (Os01g0797600) belongs to class II ERFs with a conserved EAR-motif (DLNRPPP) at the C terminal (Nakano et al. 2006). In rice, OsERF3 participated in the resistance to disease and the herbivore-induced defense responses via mediating different hormone pathways (Luet al. 2011).We also found that OsERF3 negatively
affected ethylene production and drought tolerance in rice(Wan et al. 2011). However, little is known about whether its EAR motif is involved in the regulation of ethylene synthesis and drought response. Here, we generated transgenic rice overexpressing full-length (OE) and the mutation of OsERF3 with the A680/C substitution (mEAR), respectively. The phenotypic analyses suggested that mEAR lines showed better drought tolerance and more ethylene emission than those of OE lines and wild type (WT) plants. At the transcriptional level, the substitution of Leu/Ala disrupted the repression of ACO2 and ACS6 by OsERF3 in mEAR lines. Moreover, ACS2 was significantly up-regulated in mEAR lines compared with that in WT plants. Taken together, our results indicate that the EAR motif is required for OsERF3 to repress the expression of ethylene biosynthesis genes, deepening our understanding of the regulatory function of ERF proteins involved in ethylene biosynthesis and stress response.[2]
- OsERF3 is a transcriptional repressor with an ethylene-responsive element-binding factor-associated amphiphilic repression (EAR) motif (F/LDLNxxP), which transcriptionally represses the ethylene emission and drought tolerance in rice. However, its molecular mechanism to explore repression function remains unknown.[2]
Expression
The expression of OsERF3 was induced by drought, salt, ACC and ABA treatment. In addition, it showed a higher expression level in the root and sheath than that in the leaf.
Mutation
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
- Institute of Crop Sciences/National Key Facility for Crop Gene Resources and Genetic Improvement, Chinese Academy of Agricultural Sciences, Beijing100081, China
- Shenzhen Institute of Breeding and Innovation, Chinese Academy of Agricultural Sciences, Shenzhen 518083, China
- Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing 100081, China
- National Key Facility of Crop Gene Resources and Genetic Improvement, Beijing 100081, China
- Rice Institute, Hunan Academy of Agricultural Sciences, Changsha 410125, China
References
<references>
Structured Information
| Gene Name |
Os01g0797600 |
|---|---|
| Description |
Ethylene responsive element binding factor3 (OsERF3) |
| Version |
NM_001051054.1 GI:115440478 GeneID:4327621 |
| Length |
1090 bp |
| Definition |
Oryza sativa Japonica Group Os01g0797600, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:35522840..35523929 |
| Sequence Coding Region |
35522920..35523627 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:35522840..35523929 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:35522840..35523929 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcgcccagagcagctacggtggagaaggttgctgtggcgccacccaccgggcttggtcttggcgtcggcggaggtgtcggagccgggggtcctcactacaggggcgtccgcaagcgcccgtgggggcgttacgcagcggagatccgtgaccctgccaagaagagccgggtgtggctcggtacctacgacacggcagaggaggccgcccgcgcctacgacgccgccgctcgagagttccggggtgccaaggcaaaaacaaactttccgtttgcatcacagtcgatggtcggctgtggcggcagccccagcagcaatagcacggtagacaccggtggcggcggggttcagacgcctatgcgggccatgcctctgccgccgactctggacttggatttgttccaccgcgcggctgctgtgactgcagtcgccggcaccggcgttcgctttcctttcagaggatatcccgttgcacgtccagcaacgcatccttactttttctatgagcaggctgcagcggctgccgcagctgaggctggataccgtatgatgaagcttgcaccgccggtcaccgtggcggcggttgcacaaagtgactccgactcctcgtcggtggttgatctcgcgccgtcacctccagcggttacggcgaacaaggcggcagctttcgatctggatctgaaccggccgccgccggtagagaactag</cdnaseq> |
| Protein Sequence |
<aaseq>MAPRAATVEKVAVAPPTGLGLGVGGGVGAGGPHYRGVRKRPWGR YAAEIRDPAKKSRVWLGTYDTAEEAARAYDAAAREFRGAKAKTNFPFASQSMVGCGGS PSSNSTVDTGGGGVQTPMRAMPLPPTLDLDLFHRAAAVTAVAGTGVRFPFRGYPVARP ATHPYFFYEQAAAAAAAEAGYRMMKLAPPVTVAAVAQSDSDSSSVVDLAPSPPAVTAN KAAAFDLDLNRPPPVEN</aaseq> |
| Gene Sequence |
<dnaseqindica>81..788#cacacccaaacccaacctcccaaaacacccacccggtttaccagagatccgcgcccgccacttgtaaacctgctgcacccatggcgcccagagcagctacggtggagaaggttgctgtggcgccacccaccgggcttggtcttggcgtcggcggaggtgtcggagccgggggtcctcactacaggggcgtccgcaagcgcccgtgggggcgttacgcagcggagatccgtgaccctgccaagaagagccgggtgtggctcggtacctacgacacggcagaggaggccgcccgcgcctacgacgccgccgctcgagagttccggggtgccaaggcaaaaacaaactttccgtttgcatcacagtcgatggtcggctgtggcggcagccccagcagcaatagcacggtagacaccggtggcggcggggttcagacgcctatgcgggccatgcctctgccgccgactctggacttggatttgttccaccgcgcggctgctgtgactgcagtcgccggcaccggcgttcgctttcctttcagaggatatcccgttgcacgtccagcaacgcatccttactttttctatgagcaggctgcagcggctgccgcagctgaggctggataccgtatgatgaagcttgcaccgccggtcaccgtggcggcggttgcacaaagtgactccgactcctcgtcggtggttgatctcgcgccgtcacctccagcggttacggcgaacaaggcggcagctttcgatctggatctgaaccggccgccgccggtagagaactagctcaggatgggttagctgacgactttgtagtttctctcttattttcttctttgatggatatttctctccgatgttttggtcctctgtgtttttgtttagtagcctgtgagagacggaagagccttgtaaatagtttttctgccgagggcgaaattcatcttgggatctgttaattagaacagatcatgccggcgatgagatggactaaaccgtggagtgtatgtattcctttatattagtatgaagaaattattcagaaagtcacaaaaatatctgtgcacactgagtttgattgacgtttt</dnaseqindica> |
| External Link(s) |
- ↑ 1.0 1.1 Zhang et al. BMC Genomics 2012, 13:461.Fan Zhang, Liyu Huang, Wensheng Wang, Xiuqin Zhao, Linghua Zhu, Binying Fu and Zhikang Li;Genome-wide gene expression profiling of introgressed indica rice alleles associated with seedling cold tolerance improvement in a japonica rice background
- ↑ 2.0 2.1 2.2 Haiwen Zhang • Jianfei Zhang • Ruidang Quan •Xiaowu Pan • Liyun Wan • Rongfeng Huang;EAR motif mutation of rice OsERF3 alters the regulation of ethylene biosynthesis and drought tolerance. Planta (2013) 237:1443–1451