Os02g0618400

From RiceWiki
Revision as of 07:44, 25 May 2014 by Lujia09 (talk | contribs) (Expression=)
Jump to: navigation, search

OsMPS, an R2R3-type MYB transcription factor of rice, is induced by salt stress and expressed in vegetative and reproductive tissues. In all, OsMPS is required for the adaptive growth response in rice during adverse environmental conditions.

Annotated Information

Function

1.OsMPS affects plant growth OsMPS is a direct regulator of genes encoding expansins, and it may function as a hub for multiple hormones to control plant growth. OsMPS overexpression plants were severely reduced in size under control conditions, and we find that seedlings overexpress ing OsMPS was significantly less affected by salt stress than in EV seedings.(Figure4) In a word,in the absence of stress, knockdown of OsMPS increased biomass accumulation, while OsMPS overexpression impaired growth.

2. OsMPS mis-expression causes metabolic changes related to growth In OsMPS overexpression plants, a low level of the tricarboxylic acid cycle intermediates 2–oxoglutarate, malate and fumarate was observed, and these intermediates are directly linked to plant development as their abundance is a potential growth signal. Metabolic profiling revealed that OsMPS over-expression results in accumulation of amino acids and decreased levels of tricarboxylic acid cycle intermediates, which may indicate a lower rate of protein synthesis and metabolism, correlating with the smaller plant size observed.

3.OsMPS affects heading date and panicle-related traits OsMPS is expressed in anthers and spikelets, suggesting a role in reproductive development. OE6–2 plants showed a delay in heading and flowering by 21 days, and a reduced number of panicles per plant compared to the EV line.( Figure5) Down-regulation of OsMPScaused early heading and flowering.

4. OsMPS modulates the expression of hormone and cell wall-related genes OsMPS negatively regulates the expression of several ARF and IAA genes. Interestingly, the growth inhibition of OsMPS over-expression lines was partially rescued by low concentrations of exogenous auxin. OsMPS acts as a negative regulator of auxin related genes and cell wall-remodeling genes. BR biosynthesis and signaling genes were found to be down-regulated upon over-expression of OsMPS.


Figure4.jpg

Figure5.jpg

Expression

OsMPS is expressed in most tissues, including shoots, roots, anthers and seeds, but not in endosperm, stigma, ovary or the embryo. (Figure2') OsMPS is expressed in anthers and spikelets, suggesting a role in reproductive development. However, Over-expression of OsMPS resulted in decreased plant stature at the seedling, vegetative and heading stage.(Figure3')

After salt stress induction, OsMPS can express in 30 min and 1 h , and Up-regulation of OsMPS was also observed in leaves after salt stress.(Figure1') Moreover, OsMPS expression is modulated by multiple hormones, Auxin, BL and GA, which are known to promote cell elongation (Depuydt and Hardtke, 2011), transiently decrease the expression of OsMPS.

Figure1'.jpg

Figure2'.jpg

Figure3'.jpg


Evolution

OsMPS is classified as an R2R3-type MYB TF belonging to clade C14, which includes AtMYB71, AtMYB79 and AtMYB121 from Arabidopsis and two uncharacterized rice MYB TFs. Using the web tool Phytozome (Goodsteinet al.,2012), homologous proteins from Sorghum bicolor, Zea mays and Setaria italica were identified and shown to share high sequence identity with OsMPS at the DNA-binding domain.

Localization

OsMPS contains a putative nuclear localization signal immediately downstream of the R2R3 domain

Labs working on this gene

Institute of Biochemistry and Biology, University of Potsdam, Karl Liebknecht Straße 24-25, Haus 20, 14476 Potsdam, Germany

Max Planck Institute of Molecular Plant Physiology, Am M€ uhlenberg 1, 14476 Potsdam, Germany

References

Romy Schmidt, Jos H. M. Schippers, Delphine Mieulet et al.(2013) MULTIPASS, a rice R2R3-type MYB transcription factor, regulates adaptive growth by integrating multiple hormonal pathways. The Plant Journal 76,258–273

Structured Information

Gene Name

Os02g0618400

Description

Similar to Snapdragon myb protein 305 homolog

Version

NM_001053984.1 GI:115447338 GeneID:4330001

Length

2071 bp

Definition

Oryza sativa Japonica Group Os02g0618400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:25438318..25440388

Sequence Coding Region

25438710..25439307,25439416..25439545,25440127..25440268

Expression

GEO Profiles:Os02g0618400

Genome Context

<gbrowseImage1> name=NC_008395:25438318..25440388 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:25438318..25440388 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggaagggcagcagttcgcttggggaagggaggagggagggtggaggaaagggccatggacagcgcaggaagacaagctgctggttgagtacgtgaggcagcacggcgaagggaggtggaattctgtcgccaagatcacaggtctgaagagaagtggcaagagctgcaggcttcgttgggtgaactacctgagacctgacctcaagcgaggcaagatcacgccacaggaggagagcgtcatactcgagcttcatgccttgtggggaaacaggtggtcgacgatcgcgcgtagcctgcctggcaggacggacaacgagatcaagaactactggaggacgcacttcaagaagggcaagccgtccaagaacatcgagcgcgcgagggctcggttcctgaagcagcgccgcgagatgcagcagcagagccagctgatgcaaaccggccagcagcagcagctcggccaagacgacgacgccaccagcgcggtggtggacgacaaccttgcggaggtcgcgccaccagccgccacctcgctgacccacgacggcgagctccagataatgcaggagatggcgccggacatggacgacctgctgtactaccacccgggagacatgtcgccctattcctacgacgacctcctcggcagcggcggcggcgagtgcggcgccgtggcggccagcgctggcgctgccgcctcgacgagcgagggctcaagcgaggagctcgacggcggcgccgccacgtggggcagcctgtggaacctcgacgacgtggtgcacgacatgatgatcgactgcgccgccggcgccggctgctgctggggtagcttccctccgctacaggataaaggcctcgctttctactag</cdnaseq>

Protein Sequence

<aaseq>MEGQQFAWGREEGGWRKGPWTAQEDKLLVEYVRQHGEGRWNSVA KITGLKRSGKSCRLRWVNYLRPDLKRGKITPQEESVILELHALWGNRWSTIARSLPGR TDNEIKNYWRTHFKKGKPSKNIERARARFLKQRREMQQQSQLMQTGQQQQLGQDDDAT SAVVDDNLAEVAPPAATSLTHDGELQIMQEMAPDMDDLLYYHPGDMSPYSYDDLLGSG GGECGAVAASAGAAASTSEGSSEELDGGAATWGSLWNLDDVVHDMMIDCAAGAGCCWG SFPPLQDKGLAFY</aaseq>

Gene Sequence

<dnaseqindica>1082..1679#844..973#121..262#atcgatcgcttcatcactcgctagctcatcactgcgagcggagacagctcaggagggaggaagcaaaagaagagagagagagatcaagagatagacgaagagatttgtctgtgtaaatcaatggaagggcagcagttcgcttggggaagggaggagggagggtggaggaaagggccatggacagcgcaggaagacaagctgctggttgagtacgtgaggcagcacggcgaagggaggtggaattctgtcgccaagatcacaggtaggtgctatagctactgattgagtggtgttcttgcatgttcgtgaccatttcgatgttctctcgcacgttgtcccaaatcaagaagctcgatatatatagccttttaggaagaaattatagctagtagcatcagtttgcatttggtttgttaaattgcacgttggggcagtcaaacatgcaattagtacatgtttaaggttgcatatgtcgcccatgattgtcaagttgcatgatttgattccaattgcggcatttggtacgatcgtgttttcggagaataggcatttggtgcttgctctagcacatgcattaattaattaaaccgcgtatgaactgcatgcacgcgcgtgtaaattcgtcagaaccttttcctagctgtaaccgtggaaatccttttcctagctgagagttagcttcagatgattagcattaaccaagctttactttcttagttaagtacaaatgggagtggtaggtgtgtcatgtacatgttactttttctgcatatgtacgtcagctaattctgtctgatgctatgtatcttacagtactgagcctgtgtatgtcgtgctttgcaggtctgaagagaagtggcaagagctgcaggcttcgttgggtgaactacctgagacctgacctcaagcgaggcaagatcacgccacaggaggagagcgtcatactcgagcttcatgccttgtggggaaacaggtaacaacccatttgcaaatcctttcgtgatcgagctcgatcgcgtttaattttgccatgaatgtgtaactgattcgatcgatcgcattattctctgtggcggtgtaggtggtcgacgatcgcgcgtagcctgcctggcaggacggacaacgagatcaagaactactggaggacgcacttcaagaagggcaagccgtccaagaacatcgagcgcgcgagggctcggttcctgaagcagcgccgcgagatgcagcagcagagccagctgatgcaaaccggccagcagcagcagctcggccaagacgacgacgccaccagcgcggtggtggacgacaaccttgcggaggtcgcgccaccagccgccacctcgctgacccacgacggcgagctccagataatgcaggagatggcgccggacatggacgacctgctgtactaccacccgggagacatgtcgccctattcctacgacgacctcctcggcagcggcggcggcgagtgcggcgccgtggcggccagcgctggcgctgccgcctcgacgagcgagggctcaagcgaggagctcgacggcggcgccgccacgtggggcagcctgtggaacctcgacgacgtggtgcacgacatgatgatcgactgcgccgccggcgccggctgctgctggggtagcttccctccgctacaggataaaggcctcgctttctactagctatagcttaacgattactaaattgctagctagctatagctacaagcctacacactctacaagtagatgttccttttggtcttgtgcatcgatccaaactgatagcacacagcagcctgtgcgtgtggaggaggtcacacgtagtgactatgcaggtgagagcgagaggccattttgtgtacacgaagtgttggtggataaggatgcaacaccaactatactccactttgagtagctagctcgcctcgatggcatgtttggctcatttgagagcgctttttctaggagaaaaaggaagggaagagtttttttctttgttttgcttttggagaaagaatataggaggactgcaggggggaaaatcaggtgttaaaagtgcatctgagctcttg</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0618400, RefSeq:Os02g0618400