Os01g0822900

From RiceWiki
Revision as of 07:59, 25 May 2014 by Mmma (talk | contribs) (Annotated Information)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

  • A rice Dwarf 1 gene was identified by using a map-based cloning strategy. Its recessive mutant allele photoperiod-sensitive dwarf 1(Psd) confers a dwarf phenotype.It was shown to be essential for cell division and elongation as well as the inflorescence development, which is regulated by day-length dependent signals.[1]
  • Plant height is an important agronomic trait for crop architecture and yield. Dwarf mutants in plants are crucial for elucidating regulatory mechanisms for plant growth and development. This character is also favored in breeding. Dwarf mutants have been isolated in many species and have been extensively analyzed for their mode of inheritance and their response to plant hormones. While these phenotypes induced by a recessive allele (d1) of the Dwarf(D1) gene are thought to reflect aberrant physiological and biochemical pathways in plant growth and development. The rice d1 mutant was classified as gibberellin-insensitive,[2] though most known factors determining plant height function in gibberellin or brassinosteroid or signal transduction.


Genomic structure of the Psd1 locus.jpg (from reference [1]).

Expression

  • It is expressed in elongating stem, vegetative sheath and young inflorescence.

(1)Expression analysis of flowering-related genes, Hd3a, RFT1, Ehd1, Ghd7and DTH8 in the Psd1 mutant grown under LD(long day) condition. No obvious expression change of these genes was detected in the mutant and wild-type plants, so Psd1 mutation involves the pathways for the inflorescence development and stem elongation, but not those for the cegetative to inflorescence phase transition.(Fig.2)

(2)Psd1-related genetic network is regulated by day-length dependent signals.

Figure 2. Expression analyses of five flowering-related genes of the Psd1 and ZH11 plants harvested at 12:00(from reference [1]).

Wide Type VS Mutant

  • we observed that the plant height of Psd1 mutant was increased when the plants were grown from August to October, the SD season with day-length of 12.9-11.6h. This suggested that the Psd1 phenotype might be affected by day-length, and the dwarf phenotype is suppressed under SD conditions. Therefore, Psd1 is a novel photoperiod-sensitive dwarf mutant.(Fig.3)
  • There is a big difference with the length of the third-leaf sheath between Psd1 and ZH11 plants.(Table.1)
Figure 3. Phenotypic characterization of the Psd1 mutant and ZH11 wide-type plants grown in long-day and short-day.(from reference [1]).


Table1. Length of the third-leaf sheath of Psd1 and ZH11 plants grown in dark and under light.

Responses to GA and BR

Labs working on this gene

  • Identification and characterization of the Psd1 mutant
  • responses of Psd1 mutant to GA and BR
  • Photoperiod sensitivity tests
  • Linkage analysis and gene mapping
  • RNA isolation and quantitative RT-PCR analysis
  • Expression analysis of flowering-related genes in the mutant.

References

  1. 1.0 1.1 1.2 1.3 Riqing Li, Jixing Xia, Yiwei Xu, Xiucai Zhao, Yao-Guang Liu, Yuanling Chen. Characterization and genetic mapping of a Photoperiod-sensitive dwarf1 locus in rice(Oryza sativa L.)[J] Theor Appl Genet, 2014, 127: 241-250.
  2. Mits unagas, Tashiro T, Yamaguti J. Rice gibberellin-insensitive dwarf mutant gene Dwarf 1 encodes the α-subunit of GTP-binding protein.[J] PNAS, 1999, 96: 10284-10289.

Structured Information

Gene Name

Os01g0822900

Description

Similar to Lipid transfer protein

Version

NM_001051189.1 GI:115440748 GeneID:4327617

Length

901 bp

Definition

Oryza sativa Japonica Group Os01g0822900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:36885860..36886760

Sequence Coding Region

36886214..36886223,36886310..36886662

Expression

GEO Profiles:Os01g0822900

Genome Context

<gbrowseImage1> name=NC_008394:36885860..36886760 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:36885860..36886760 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgataaactag</cdnaseq>

Protein Sequence

<aaseq>MAPRCATLAVVVVLVAAVVAPPTAVRAAISCSAVYNTLMPCLPY VQAGGTVPRACCGGIQSLLAAANNTPDRRTICGCLKNVANGASGGPYITRAAALPSKC NVSLPYKISTSVNCNAIN</aaseq>

Gene Sequence

<dnaseqindica>538..547#99..451#acacgtttcagctgtctttcagtgttcacgtaggttgtagagagcacaacaacgtacgtacacagcagcaaagactgagactagctagcttagctgacatggctccaaggtgcgcgacgctggcggtggtggtggtgctggtggcggccgtggtggcgccgccgacggcggtgcgcgcggctatctcgtgctcggcggtgtacaacacgctgatgccgtgcctgccgtacgtgcaggcggggggcacggtgcccagggcgtgctgcggcggcattcagagcctgctcgccgccgccaacaacacccccgatcgccgcaccatctgcggctgcctcaagaacgtcgccaacggcgcctccgggggcccctacatcacccgcgccgccgcgctcccctccaagtgcaacgtctccctcccttacaagatcagcaccagcgtcaactgcaacgcgtacgtgcacgcataaacactctcatactctcattaaacgaagtagaaaatttttacagacaaatttaatttctttctttgtgcaggataaactagggcggccggcctgatgcgtacgtgtgtgcccgcgcctcccgtacgagaggagaataaaatgtcattagtaccatcaaattaagctagctagttaagctttacgaaaatcgatccctttcttcctctgtggtgtttagcagtttagggatcgtatgtctccacagttcctactatagtgtcgcttgggcgatggtggagctatattgtgcactttataaggtggtgttattatgtaacgcctgtgctagctttggtcctgatgttctccatgtgaactgtgtcaaccgtccattgttctgcaaatctgcagtatgtactgtgtgtgatagtatcaagctgaacttctgaacatgc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0822900, RefSeq:Os01g0822900