Os05g0100401

From RiceWiki
Revision as of 06:29, 26 May 2014 by Haiyang (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here. Rice (Oryza sativa), a salt-sensitive species, has considerable genetic variation for salt tolerance within the cultivated gene pool. Two indica rice genotypes, FL478, a recombinant inbred line derived from a population developed for salinity tolerance studies, and IR29, the sensitive parent of the population, were selected for this study. We used the Affymetrix rice genome array containing 55,515 probe sets to explore the transcriptome of the salt-tolerant and salt-sensitive genotypes under control and salinity-stressed conditions during vegetative growth. Response of the sensitive genotype IR29 is characterized by induction of a relatively large number of probe sets compared to tolerant FL478. Salinity stress induced a number of genes involved in the flavonoid biosynthesis pathway in IR29 but not in FL478. Cell wall-related genes were responsive in both genotypes, suggesting cell wall restructuring is a general adaptive mechanism during salinity stress, although the two genotypes also had some differences. Additionally, the expression of genes mapping to the Saltol region of chromosome 1 were examined in both genotypes. Single-feature polymorphism analysis of expression data revealed that IR29 was the source of the Saltol region in FL478, contrary to expectation. This study provides a genome-wide transcriptional analysis of two well-characterized, genetically related rice genotypes differing in salinity tolerance during a gradually imposed salinity stress under greenhouse conditions.

References

Please input cited references here. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan. PMID 18089549 Rice Annotation Project, et al. Genome Res, 2007 Feb. PMID 17210932 Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1. PMID 16381971 International Rice Genome Sequencing Project. Nature, 2005 Aug 11. PMID 16100779 Comparative Transcriptional Profiling of Two Contrasting Rice Genotypes under Salinity Stress during the Vegetative Growth Stage Harkamal Walia, Clyde Wilson, Pascal Condamine, Xuan Liu, Abdelbagi M. Ismail, Linghe Zeng, Steve I. Wanamaker, Jayati Mandal, Jin Xu, Xinping Cui, Timothy J. Close Plant Physiol. 2005 October; 139(2): 822–835. doi: 10.1104/pp.105.065961

Structured Information

Gene Name

Os05g0100401

Description

Conserved hypothetical protein

Version

NM_001187234.1 GI:297723598 GeneID:9271261

Length

2120 bp

Definition

Oryza sativa Japonica Group Os05g0100401, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:16632..18751

Sequence Coding Region

17568..17724,17801..17964,18596..18751

Expression

GEO Profiles:Os05g0100401

Genome Context

<gbrowseImage1> name=NC_008398:16632..18751 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:16632..18751 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>cagcttcaagcgatagcttctgacgaaatggataacaagctgctccaactttacatatacgaaaaatccaggtcacctgggagattctttgatctagtttatcatgaaaatgcgcgtgtacttctccatgatgagagcatatatcgatttgaacggcgttcaaatcctacaagattatcaattcagctaatggagtatgggcatgaaaaacctgaagtaactgcagtgtcaattgatccaaatttttcgtcttatctatataatgagtatctgtcaagtatttctaatactaaattgtatgacgatatcttccttgggaggaataaacggaagcgtgggggaaacgatgactctcaagcttctttgaaggccattgatgctttcatggttactaatggtcttgaatgcaagatatcctgcaaatcctcaaaggtactcataattttagcgagaattttgtgccccattgcaagttaa</cdnaseq>

Protein Sequence

<aaseq>QLQAIASDEMDNKLLQLYIYEKSRSPGRFFDLVYHENARVLLHD ESIYRFERRSNPTRLSIQLMEYGHEKPEVTAVSIDPNFSSYLYNEYLSSISNTKLYDD IFLGRNKRKRGGNDDSQASLKAIDAFMVTNGLECKISCKSSKVLIILARILCPIAS</aaseq>

Gene Sequence

<dnaseqindica>1028..1184#788..951#1..156#cagcttcaagcgatagcttctgacgaaatggataacaagctgctccaactttacatatacgaaaaatccaggtcacctgggagattctttgatctagtttatcatgaaaatgcgcgtgtacttctccatgatgagagcatatatcgatttgaacgggtaagtatttttacaatatccatgtttcttatttcgatacttttgcagtgccttattaccatgcaatattgttgctgcgacgaatgccaaataaatatactaccatattttgaagttaaaagtgcaaaattttctatcatcaaatataaaaaaaaatctataattcactacatgagatcaatcagcaactaggttgtgcgaagaacaatgtttcaaaagtatgctgcaaacaaaccacacctgtaaatgtttatccagcaacagagtatcttgtggagtggtggattggtgttgagcacacaagtttgaactgtttttatgaagtaaagaaaccctctttcttgctagtagttctgacttggtgcagagacttctgtaatgcctttagatgccttcgattcagagtttcagaccctccatggctccaccagtctagttttctagggtcaacaaatagagtgatacttctgcaagaaacgggaataccattgtataagggaaacctgaataccgttgtaaaaggggtgctagcaattttgacaattttttttcctgcctttatctgctaatgctatgtggcacaaggattttttgaccatgtatgtgacacagttttccttgtgatttgcagcgttcaaatcctacaagattatcaattcagctaatggagtatgggcatgaaaaacctgaagtaactgcagtgtcaattgatccaaatttttcgtcttatctatataatgagtatctgtcaagtatttctaatactaaattgtatgacgatatcttccttgggaggtactttcctgatcttatgttggagtctcaattttactttccacggctattttcattgttggacatcatttcccaggaataaacggaagcgtgggggaaacgatgactctcaagcttctttgaaggccattgatgctttcatggttactaatggtcttgaatgcaagatatcctgcaaatcctcaaaggtactcataattttagcgagaattttgtgccccattgcaagttaacattgtatctagcagaacccttttgattgatcatgataccattttgaccattttaatgttgtattttgtaatgctcaatatcttatttgcaggtttcctatgtccttgatactgaagatttcttatttcatataagaaagaggagagtttcatctagtggaaccatacctgaaaaggcggattttgtgaaagcttatgctgtaaaagtacagcgattccatagatttctatcaaggccctagggttaagcggcgaaattctggtaatcttttagctttattagattgtcattatgagcttcatgtttagtaaccttcacatgcatctttatattgtagtcagtcatcatatctggtaaagttacttatatgctgcttttgatcagttatacacgccgctgtctcatctatactctatatgtaggttgcacttagtttgctcccatcaaacgtgagcatcttgaaacttaactagcatcagtcaccactgcacaccatgcatcttgatttttgccaacaataaaagaaaaagacccttgaatctgagcatctacatccacgtttactgaatgcaatgtctctacaggcatgactgctgttaatttaaaacgatatttgtgatgtttctggtttgcagccgctgtatcaaatccgagatgctgacgtgcttcgaaaactgccatgtgaaccttaatattccaaaatttcagacaactgtacctttggaataatagatgggatactctggtaaatgctgaagtgtgtggcaaccgtgagttctcttaatggcctaaaattgtgtacatatgtatcatgagaatgcatttattcaggttaattgtactggctacactaacttgtcactcctgttaatatagttttgcatgttatcctatttttcttgggtgctatctgatacgcgcatgttcatgatgtt</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0100401, RefSeq:Os05g0100401