Os01g0667400

From RiceWiki
Revision as of 08:00, 26 May 2014 by Liying (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa).

DWARF TILLER1 (DWT1) controls the developmental uniformity of the main shoot and tillers in rice (Oryza sativa). DWT1 mutant has no obvious morphological difference with wild-type plant at the initial vegetative stage. However, DWT1 developes dwarfed tillers with the main shoot having nearly normal height during the reproductive stage. DWT1 tillers have shorter internodes with fewer and un-elongated cells, indicating that DWT1 affects cell division and cell elongation. DWT1 encodes a WUSCHEL-related homeobox (WOX) transcription factor homologous to the Arabidopsis WOX8 and WOX9.

Error creating thumbnail: Unable to save thumbnail to destination
Morphology of the wild type and dwt1 plants after heading
Error creating thumbnail: Unable to save thumbnail to destination
Mature main shoots and tillers with leaves removed from the culm
Error creating thumbnail: Unable to save thumbnail to destination
Close-up view of the internodes after heading stage
Error creating thumbnail: Unable to save thumbnail to destination
Morphology of panicles from the main shoot (MS) and tillers (TS) of wild type (WT) and dwt1 after heading

Expression

The DWT1 gene is highly expressed in young panicles, but undetectable in the internodes, suggesting that DWT1 expression is spatially or temporally separated from its effect on the internode growth. Altered expression of genes involved in cell division and cell elongation, cytokinin/gibberellin homeostasis and signaling have been revealed in DWT1 shorter internodes. Previous reports indicated no effect of these hormonal pathways on the coordination between the tiller and the main shoot growth, but latest resoults reveals that the DWT1 activity is directly or indirectly associated with GA signaling in the internode elongation.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1 State Key Laboratory of Hybrid Rice, School of Life Sciences and Biotechnology, Shanghai Jiao Tong University, Shanghai, China

2 Key Laboratory of Plant Molecular Physiology, Institute of Botany, Chinese Academy of Sciences, Beijing, China

3 Graduate University of the Chinese Academy of Sciences, Beijing, China

4 Department of Plant Biology, Carnegie Institution for Science, Stanford, California, United States of America

References

1. Wenfei Wang;Gang Li;Jun Zhao;Huangwei Chu;Wenhui Lin;Dabing Zhang;Zhiyong Wang;Wanqi Liang

 DWARF TILLER1, a WUSCHEL-Related Homeobox Transcription Factor, Is Required for Tiller Growth in Rice
 PLoS Genetics, 2014, 10(3): e1004154

2. Wenfei Wang;Huangwei Chu;Dabing Zhang;Wanqi Liang

 Fine Mapping and Analysis of DWARF TILLER1 in Controlling Rice Architecture
 Journal of genetics and genomics, 2013, 40(9): 493-495

Structured Information

Gene Name

Os01g0667400

Description

Conserved hypothetical protein

Version

NM_001050343.1 GI:115439056 GeneID:4326320

Length

1538 bp

Definition

Oryza sativa Japonica Group Os01g0667400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:29046116..29047653

Sequence Coding Region

29046806..29047498

Expression

GEO Profiles:Os01g0667400

Genome Context

<gbrowseImage1> name=NC_008394:29046116..29047653 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:29046116..29047653 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtccgtgacgacggccatggacctgctctcgccgctcgccgcggcgtgccaccagcagatgctctatcaaggccagccactggagtcgccgccggcgcctgctcccaaagtgcacggcatcgtgccacacgacgagccggtcttcctgcagtggccgcagagcccctgcctgtcggccgtcgacctcggcgccgccattcttggcggccagtacatgcacctgccggtgcccgctccgcagccaccgtcgtcgccgggcgcggcgggcatgttctgggggctctgcaacgacgtgcaagcgccaaacaacaccggccacaagagctgcgcctggagcgccgggctcggccagcactggtgcggctccgccgatcagctcggcctcggcaagagcagcgcggcgtcgatcgccaccgtgtctaggccggaggaggcgcacgacgtcgacgccacgaagcacggtctgctacagtacggctttggcatcaccacgccgcaagtgcacgtggacgttacctcctcggctgctggcgttctgcctcctgttccgtcctcgccgtcgccgccgaacgccgccgtcaccgtcgcgagcgtggccgccaccgctagcctgactgattttgctgcaagtgctatatctgctggcgccgtcgctaacaatcagtttcaaggtactctttttgttctttga</cdnaseq>

Protein Sequence

<aaseq>MSVTTAMDLLSPLAAACHQQMLYQGQPLESPPAPAPKVHGIVPH DEPVFLQWPQSPCLSAVDLGAAILGGQYMHLPVPAPQPPSSPGAAGMFWGLCNDVQAP NNTGHKSCAWSAGLGQHWCGSADQLGLGKSSAASIATVSRPEEAHDVDATKHGLLQYG FGITTPQVHVDVTSSAAGVLPPVPSSPSPPNAAVTVASVAATASLTDFAASAISAGAV ANNQFQGTLFVL</aaseq>

Gene Sequence

<dnaseqindica>156..848#tcacgccgccgccaccaatcctcccggcgccccagccggtgcagccgcagcagcagcttgtctcgcctgtggcggcgcctacctcgtcgtcgtcttcctcctccgaccgttcgtccgggtccagcaagcctgcgagggctacgtcgacgcaggcgatgtccgtgacgacggccatggacctgctctcgccgctcgccgcggcgtgccaccagcagatgctctatcaaggccagccactggagtcgccgccggcgcctgctcccaaagtgcacggcatcgtgccacacgacgagccggtcttcctgcagtggccgcagagcccctgcctgtcggccgtcgacctcggcgccgccattcttggcggccagtacatgcacctgccggtgcccgctccgcagccaccgtcgtcgccgggcgcggcgggcatgttctgggggctctgcaacgacgtgcaagcgccaaacaacaccggccacaagagctgcgcctggagcgccgggctcggccagcactggtgcggctccgccgatcagctcggcctcggcaagagcagcgcggcgtcgatcgccaccgtgtctaggccggaggaggcgcacgacgtcgacgccacgaagcacggtctgctacagtacggctttggcatcaccacgccgcaagtgcacgtggacgttacctcctcggctgctggcgttctgcctcctgttccgtcctcgccgtcgccgccgaacgccgccgtcaccgtcgcgagcgtggccgccaccgctagcctgactgattttgctgcaagtgctatatctgctggcgccgtcgctaacaatcagtttcaaggtactctttttgttctttgatatgaagaatttaattaactggtcaaatcatgaatcaccaccatttagctagattatctgttggcattttttcccctttgttcagtatcacatgcatgcatcatattcatacgctcatgtttaaatggattaattagaagtgtcacttcaggggagtctaacttctcttgtagtgttgtcctcaatttcagtttcgtttggatttaactacaaaatgacaaattttttactgaaagaagaattgtatatgcatgaaattgtactgtactagtttcctttagggcccaatccaaaccagccgttctcaaacaagggccctgtgcccaggcatggcaatgataataagacaagtttaggccatgtaaaatccttttcttttgtgtgtctgtacaatcttatcacttcaatgcagatagactttccagtaaagatgaagaaatttgtcattttgtaagcatgtagatttagacaagaccaaaatttgtgagctgttctccatcaggtcaaattgagtaggtttcttgatgggatgttacaaatatgcgaactactagtactactgctatttcatggtgatggggaacatcatgtcatcgcatgtagatgcattcagctcccacatgctccctccatccaaaaaaaagacaaaccctggtttgcatgtgcaacgtttgaccgtccgtcgtattt</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0667400, RefSeq:Os01g0667400