Os04g0475600

From RiceWiki
Revision as of 01:31, 27 May 2014 by Lixn.big (talk | contribs) (References)
Jump to: navigation, search

This gene named dioxygenase for auxin oxidation gene or 2-oxoglutarate-dependent-Fe (II) dioxygenase.Its gene symbol is DAO.This gene code 2-oxoglutarate-dependent-Fe (II) dioxygenase which is essential for anther dehiscence, pollen fertility, and seed initiation in rice.In vitro recombination,the gene DAO make active IAA into no biological activity of 2 - indole 3 acetic oxide. Rice mutant lines lacking a functional DAO display increased levels of free IAA in anthers and ovaries.

Expression

Please input expression information here. The identification of the rice dioxygenase for auxin oxidation (DAO) gene, which encodes a 2-oxoglutarate-dependent-Fe (II) (2OGFe (II))dioxygenase responsible for catalyzing the irreversible oxidation of IAA to OxIAA and essential for plant reproductive development.Sequence and phylogenetic analysis showed that DAO is a single copy gene in rice that is predicted to encode a 2OG-Fe(II) dioxygenase with a dioxygenase domain that is conserved in several classes of dioxygenase, including the GA-2 oxidase(GA2ox), GA-3 oxidase (GA3ox), and GA-20 oxidase (GA20ox).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will. This gene is belong to oryza sativa and it is one of the world's oldest crop specise.In a heavy huge scale study,US researchers have thought oryza sativa orginated in China.As soon as 800 years ago appear in the Yangtze basin China.This gene is on the fourth chromsome in the rice.

Labs working on this gene

Please input related labs here.


Shenyang Institute of Aeronautical Engineering, Feng-t’ien, Liaoning, China

Climate Stress Laboratory Janet P. Slovin

Horticultural Crops Quality Laboratory Jerry D. Cohen

United States Department of Agriculture, Beltsville, Maryland

References

Please input cited references here.

[1]Spielmeyer, W., Ellis, M.H., and Chandler, P.M. (2002). Semidwarf (sd-1),‘‘green revolution’’ rice, contains a defective gibberellin 20-oxidase gene.Proc. Natl. Acad. Sci. USA 99, 9043–9048.

[2]Normanly, J., Slovin, J.P., and Cohen, J.D. (1995). Rethinking auxin biosynthesis and metabolism. Plant Physiol. 107, 323–329.

[3]Zhigang Zhao, Yunhui Zhang, Xi Liu.ect(2013)A Role for a Dioxygenase in Auxin Metabolism and Reproductive Development in Rice.

Structured Information

Gene Name

Os04g0475600

Description

2OG-Fe(II) oxygenase domain containing protein

Version

NM_001059610.1 GI:115458949 GeneID:4336150

Length

1939 bp

Definition

Oryza sativa Japonica Group Os04g0475600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:24194135..24196073

Sequence Coding Region

24194432..24194674,24194894..24195212,24195312..24195652

Expression

GEO Profiles:Os04g0475600

Genome Context

<gbrowseImage1> name=NC_008397:24194135..24196073 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:24194135..24196073 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtggagatcccggcgatcgacctgcggctggccggcggcggcggcggcgcggaggagacggcgaggctgcgcgacgcgtgcgcgcggctgggctgcttccgggtgtcggggcacggcgtgccgccggggctccaggccgagatgaaggccgcggtgcgcgcgctcttcgacctccccgacgacgccaagcgccgcaacgccgacatcatcccgggcagcggctacgtcccgcccggcacagccaacccgctctacgaggccttcggcctctgcgacgccgccgcccccgccgacgtcgacgccttctgcgcccgcctcgacgcgccgccccacgtcagggagaccgtgaaggcgtacgccgagaggatgcactcgctgatcgtggacgtcgccggcaaggtcgccgcgagcctggggctgcacggcgcctcgttccaggactggccgtgccagttccgcatgaacaggtacaactacacgcaggactccgtgggctcccccggcgtgcaggtccacacggactccggcttcctcaccgtgctccaggaggacgagtgcgttggcgggctcgaggtgctcgaccccgccgccggcgagttcgtccccgtcgaccccctccccggctcgttcgtcgtcaacgtcggcgacgtcggccaggcgtggagcaacgggaggctgcacaacgtgaagcacagggtgcagtgcgtggcggcggtgccgcgcgtgtcgatcgccatgttcctgctggcgcccaaggacgacacggtgagcgcgccgggggagctggtggacggcgagcacccgcgccggtacagggagttcaagtacgacgactaccggaggctccggctgtccaccggcgagcgcgccggcgaggcgctcgcgcgtctggcggcctga</cdnaseq>

Protein Sequence

<aaseq>MVEIPAIDLRLAGGGGGAEETARLRDACARLGCFRVSGHGVPPG LQAEMKAAVRALFDLPDDAKRRNADIIPGSGYVPPGTANPLYEAFGLCDAAAPADVDA FCARLDAPPHVRETVKAYAERMHSLIVDVAGKVAASLGLHGASFQDWPCQFRMNRYNY TQDSVGSPGVQVHTDSGFLTVLQEDECVGGLEVLDPAAGEFVPVDPLPGSFVVNVGDV GQAWSNGRLHNVKHRVQCVAAVPRVSIAMFLLAPKDDTVSAPGELVDGEHPRRYREFK YDDYRRLRLSTGERAGEALARLAA</aaseq>

Gene Sequence

<dnaseqindica>1400..1642#862..1180#422..762#agaagcaaacactgcgatcatccgaagcaatctcaatctcacctgtccatatcgcgcacgaattcgtaaagtgcaagctagaaacatgtgtcacatgtcgtgctgatcgttcgatccaccacggtgcgagcggtgagtgtcgtgacgaagcaaaggcagaggcagcagcgggaaacggcgcccccccgtgtgtcgatcggctgtctcgccgaacagggcaaatacgccaacaaaaaacggcctcgttttcccttgctcgcacgcaccgtgtcgctcccaggcgacaagccgtggcgcgactcgccgcccccctgcgccccctcgcccccgcgcgtcgctttcacgtcgcacctctaaataccaccaccccggactcggcggcgagcccccgcgccaagaacgaaaggcgagagtgagagagatggtggagatcccggcgatcgacctgcggctggccggcggcggcggcggcgcggaggagacggcgaggctgcgcgacgcgtgcgcgcggctgggctgcttccgggtgtcggggcacggcgtgccgccggggctccaggccgagatgaaggccgcggtgcgcgcgctcttcgacctccccgacgacgccaagcgccgcaacgccgacatcatcccgggcagcggctacgtcccgcccggcacagccaacccgctctacgaggccttcggcctctgcgacgccgccgcccccgccgacgtcgacgccttctgcgcccgcctcgacgcgccgccccacgtcaggtgaccatttactgatcttgcaccgccccccaatcccaattggaattgcgattttggtctcaagaaacggatgaattaatccgggcccggatgaagcagggagaccgtgaaggcgtacgccgagaggatgcactcgctgatcgtggacgtcgccggcaaggtcgccgcgagcctggggctgcacggcgcctcgttccaggactggccgtgccagttccgcatgaacaggtacaactacacgcaggactccgtgggctcccccggcgtgcaggtccacacggactccggcttcctcaccgtgctccaggaggacgagtgcgttggcgggctcgaggtgctcgaccccgccgccggcgagttcgtccccgtcgaccccctccccggctcgttcgtcgtcaacgtcggcgacgtcggccaggttcacaaacatatcatcaaaatatattcaatttaattactaaaattaataagatatatccctccgtcggtgctgtaggtgttgttatttttctataaatttgattcaacctaaaaatattaagaaaatatcaaacgacttataattcgagacgaagggagtaactactattccatttttcgcgggaatttctcaccgaatctcggtgtgttgtctcaggcgtggagcaacgggaggctgcacaacgtgaagcacagggtgcagtgcgtggcggcggtgccgcgcgtgtcgatcgccatgttcctgctggcgcccaaggacgacacggtgagcgcgccgggggagctggtggacggcgagcacccgcgccggtacagggagttcaagtacgacgactaccggaggctccggctgtccaccggcgagcgcgccggcgaggcgctcgcgcgtctggcggcctgacacctggccacggtccattgtcgcgaccgtttattacgcggagtgctcactgctgactagaatgtccattaggcctccctgtatggccgtgtcgattctgaacaataaaatcttcgacgtacgacagtgaaaaaaatttgtaaaggatgctgaggggatgggaattttaggggttaataagtcttttgtttggctggaggagatgatgagttgtaggaataactggaaggtggagtttgtgagtaaattcccacctttttaatatagaggactataattgggaggaaagtccctttc</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0475600, RefSeq:Os04g0475600