Os05g0145000

From RiceWiki
Revision as of 13:11, 27 May 2014 by Alison (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

File:Fuctional mutant.jpg
Figure 1. Functional complementation of ptb1. (a) Plant phenotype of ptb1. (b) Plant phenotype of the PTB1-transformed ptb1 plants (ptb1–PTB1).(c) Panicle phenotype of ptb1. (d) Panicle phenotype of the ptb1–PTB1 transgenic plants. (from reference[1]).

The domestication-related POLLEN TUBE BLOCKD 1(PTB1), a RING-type E3 ubiquitin ligase, positively regulates the rice panicle seed setting rate by promoting pollen tube growth. The PTB1 positively regulates rice PSSR through controlling pollen tube growth. Shuangcheng et al(2013) support the hypothesis that PTB1 is an important maternal sporophytic factor of pollen tube growth and a key modulator of the rice panicle seed setting rate.
There are many genes that related to the grain yield such as GS3/5, GW2/5/8, GL3.1 and TGW6, but as we know now, no genes regulates PSSR(which is one of the most important yield determinants) have been functionally characterized. Rice PSSR is impressionable to outside environmental conditions, which often cause large rice yield losss and threatens the safety of rice production. Nowadays, compared with the parents, many hybrid rice varieties exhibit sharp decreases in PSSR, the finding of the PBT1 gene has implications for the improvement of rice yield.
PTB1 has pleiotropic effects on PT growth control. First, it has a decisive role in entering and early growth of the STT.Second, PTB1 functions during the later navigation of PTs in the STT because a lower level of PTB1 expression leads to different numbers of PTs growing in this process.Third, PTB1 promotes growth from the chalazal end of the sporophytic STT to the micropyle because a moderate expression of PTB1 leads to the growth of few PTs in this female location.Finally, PTB1 functions as a promoting agent based on the observation that a higher expression of this gene encourages more PTs to complete their full journey[1].

Expression

Figure 2. Expression patterns of PTB1. (a–h) GUS activity in various organs of PPTB1-GUS-transformed rice plants. (a) Growing root, (b) stem node, (c) stem internode, (d) leaf, (e) floret, (f) pistil, (g) shell of unpollinated spikelet and (h) pollen grains. (i) Relative PTB1 transcript levels of several tissues detected by q-PCR analysis. DAP, days after pollination. Values represent the mean±s.e.m. (n?3). Scale bars, 400 mm in (a), 3mm in (b) and (c), 1 cm in (d), 1mm in (e) and (f), 4mm in (g) and 50 mm in (h). (from reference[1]).

The natural variation in expression of PTB1 which is affected by the promoter haplotype and the environmental temperature, correlates with the rice panicle seed setting rate. The GUS gene test in rice showed that PTB1 was differentially expressed in various rice tissues: the expression of PTB1 was relatively weak in the root, shoot and leaf, and the expression was strong in the stigma of the pistil and the spikelet hulls of the pre-emergence panicle. But , in rice pollen grains,the expression was undetectable. The results of Q-PCR was further confirmed this temporal and spatial expression patterns by showing that PBT1 was expressed prior in the reproductive organs such as the pistil, young panicle,pre-emergence panicle and post-emergence panicle. This pattern corresponded well to the role PBT1 played in the pollen tube growth[1].
The transient expression of PBT1-YFP fusion protein in rice protoplast cells showed that the PBT1 localized preferentially to the cytoplasm and although the PBT1 protein was predicted to contain 4 transmembrane segments, it was weakly expressed on the membrane.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

<references>

Structured Information

Gene Name

Os05g0145000

Description

Similar to Ring finger protein (Fragment)

Version

NM_001061164.1 GI:115462058 GeneID:4337790

Length

5616 bp

Definition

Oryza sativa Japonica Group Os05g0145000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 5

Location

Chromosome 5:2576595..2582210

Sequence Coding Region

2576763..2577185,2577792..2577905,2578448..2578564,2578770..2578835,2579376..2579468
,2579552..2579690,2581077..2581150,2581225..2581291,2581746..2581784
,2581880..2581908

Expression

GEO Profiles:Os05g0145000

Genome Context

<gbrowseImage1> name=NC_008398:2576595..2582210 source=RiceChromosome05 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008398:2576595..2582210 source=RiceChromosome05 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgatgcggggggtcgatttcaagtggtacgatggattcttcctctccatgctcgccaccagcctaatcattgtctccatcaactggaagaggtatcgtctctgcgcccacccgttgcacatatggatcgtggttgactacaccaccgtcttcatcttccgccttctcatgttcgtcgataatggccttgccgccggcatgggattggatcttggatggcaacagagatatgctcgtttttgtgggagaattgttgtcttgtcggttcttgtgcttcttctctatccctttctttgggtttggactgtgataggaacattgtggtttagcactgcaagaggctgtttacccgaggaaggacaaaaatggggcttccttatatggctgcttttcagctactgtggtctcgcctgtattgcgtgtgtggctgttggaaagtggctaagccgaaggcatgctctccagcagagggcacaacagggaataccagtctctgaatatggggttttggttgacatgatccgtgtgcctgattgggcatttgaggccgttggcttggaaatgagaggaatgggccaagatactgcatatcatcctggtctttatttaacagctgcccaaagagaggcagttgaggcactgattcaagaactcccgaagttcagactgaaagctgttcctacagactgcagtgagtgtccaatctgcctggaggaattccatgttggcaacgaggtccgtgggctcccgtgcgcgcacaatttccatgtggagtgcatcgaccagtggctccggctgaatgtcaagtgcccccgttgccggtgctccgtcttccccaacctcgacctgagcgcgctcaacaacctccggccatcctccgagccggaccggccgtcggccagcgaggtgacagcggcgacgatggcgcggtacgtgaggtcgtcgcagccggctgggcagagctacctgctgcggctgcaggggctgctgctgcggcaggtggtggttcggcacggcggcggcgacgacatggcgagcgccgagaacggcgcttctcatgtggccgccgcggtgaccgcgccggcgaccaccggcggcgtggagagcgagctgcctagcatagtggttgacggtgggcatcagctgccggatcgctga</cdnaseq>

Protein Sequence

<aaseq>MAMRGVDFKWYDGFFLSMLATSLIIVSINWKRYRLCAHPLHIWI VVDYTTVFIFRLLMFVDNGLAAGMGLDLGWQQRYARFCGRIVVLSVLVLLLYPFLWVW TVIGTLWFSTARGCLPEEGQKWGFLIWLLFSYCGLACIACVAVGKWLSRRHALQQRAQ QGIPVSEYGVLVDMIRVPDWAFEAVGLEMRGMGQDTAYHPGLYLTAAQREAVEALIQE LPKFRLKAVPTDCSECPICLEEFHVGNEVRGLPCAHNFHVECIDQWLRLNVKCPRCRC SVFPNLDLSALNNLRPSSEPDRPSASEVTAATMARYVRSSQPAGQSYLLRLQGLLLRQ VVVRHGGGDDMASAENGASHVAAAVTAPATTGGVESELPSIVVDGGHQLPDR</aaseq>

Gene Sequence

<dnaseqindica>5026..5448#4306..4419#3647..3763#3376..3441#2743..2835#2521..2659#1061..1134#920..986#427..465#303..331#gaaaagcttcttcgcttcgccgcctcctccccctctctccggcgcgttcgccgctcgcgatcctcccggcgccgccgccgccgccgcgcgggggccctactcgcgtcgacgccgggagggggacgccgtactccctcctcctcgcgtcgccccgccccgccgccgagtgcgacgccgctctctctctctctctcctcgcgagaaaccctagctggagttgaagtgaggggctcactgaagtgagcggagtgcgggggcgtggatgctgccgcgctcctccggccagatctagctagcaggccatggcgatgcggggggtcgatttcaagtggtactaagtttattctctactccccccttccccgctatggctgtaatatgctttgaagaatctattcatctgttgctttgcttgattggtttcaggtacgatggattcttcctctccatgctcgccaccagcctgtatcctttcatcatttcctcaccatgctttcagttttaattattagaatttcgctcgccgcgcgttcagtttttgttagagtcgattacgttttgcaccagttagattaacctacatttcaatttgcaccggactaggtgcaatgggttgggcgggtgttatgtgaatgcaaagtgaaagtttagactaaacctggtggattttttcttcttttttgacataagaaggtagagccagctaccttattaacttatagccatttcattgacaaaaatagatggttacaaagttacaggaagaaggtacatgaaaaagaggaaggtaaaaaggggaggaaaaaagggggagaatgtacaaaacatggtggaaaaatgaaacaatttacccagtgcaatgtgcattttactgatacattttcatcgattgctattgttcctcctcaactttgtccagaatcattgtctccatcaactggaagaggtatcgtctctgcgcccacccgttgcacatatggatcgtggtcagttcctcaatccaacatctatctcaaatcaaaccgctattcctctatctcactctctcatcttttcccaggttgactacaccaccgtcttcatcttccgccttctcatgttcgtcgataatggccttgccgccggcatgggattgtaagtttataactactatctccttctatttcaacctcatctctcctgtcacaatatacctatggtagacctacaaatggattgtaggggtaaagacagtggttgtcattttcctctgctttgggtgggctgttctgttctgctagacagaacaaatctgtaccattttgaccccaaacttaccactgggtttagttctttttaattatggactagtatgaaatttgcatacatgaaattttgatgtcacccctaaatcgagaaaagcagcctagcaaaaaaggaagaacaacaattgacaatgacatttgtaccctttcgggagaaaaggaaattcctgtaataggcaacctgaccaatttttgtcttgactatcttgattgcaacctcagcctccgctctttttaaacgagcaaattataattaaaatacgtttatgaagggacataaggctaaacagcctctttgcatggttattacctgagcagatgagatataaccttttaaccgtctgctaattttggatgagttcatggcgcaaaacaatatagtttgtagtgcaaaacaatatagtttgtagtttcaacatttcagaagatagaagtctcaatttatttttatttagccattactgtattatttttcttctgtgcaacttactgtcttattttgaagatttgccgtaatatgccattgaaatatttcatatttagatttttgtagtattaccattttaacgtgtaacttcaaagttcaaacagaatatgctcttagaatattttctaagactagctgtatgcccacatgtttgatacagataaaaatgaatagaataagtctgtttgcattttcggaacatatatatgtgattgttgcattgaacctgtaaaccttttccttttctgttacaagagcacttgacaatgtctacacatgtctatttgtaaaatttggtcatcttcgacatttccatgtaaaattgcgaatttagaaagccaaatacaaaaaaaagggaaaaaaataaacaacatttggaaggtagaagtgtcattttcaggaatttaagggagcaattagtaagaaatttagtggaggtgttggtagcagattccctgccaccacactaccttctttctaaaggagtacatataacaaatttgtcattctgtgataaagaaacagcatgcaagaggtgtttctatcattaaagcaacactgtgcaataggacagcacataagtatttcctcttacagttgtaagaggcttgagtatcgcctacaaaatagagttgctaacttgccaatgtccacctttgtatgttggtccttaccttctaaacttttccaaagtatgacgtttgtcctttttgtggctggtaattgtagggatcttggatggcaacagagatatgctcgtttttgtgggagaattgttgtcttgtcggttcttgtgcttcttctctatccctttctttgggtttggactgtgataggaacattgtggtttagcactgcaagaggctgtgtaagttttcttattgttatggtattatgctcatcaccaaatatttagaagttttacttaacatacactcactctatatgtagttacccgaggaaggacaaaaatggggcttccttatatggctgcttttcagctactgtggtctcgcctgtattgcgtgtgtggctgttggaaaggtactgctataagatatgtcggtacaaactgcaatcttgcattggatccgcatattatcgttcatcgatttatccatgattactgtgcaaagattcagtcttcttgagtgtcataccatcagtcatacatactatatctagatgtcatttagattgaagatgttaaggttttagttatagagaattgttatttggcattgatgtattcataatttcatatcttctttgcatcatctagaaatcgtatccatttatttttttcttcttttaaaagcatgaagggtagtgtacgtcttccttcatattgactattagtgcagaagccatactgatagcagaaccctaatcctcatggttgtactggctttagatctttttttagtcagaacttttggtagatttcttgtaattttattttgccttcttattttaataaagcaactgtgggggctttccctacagcgcttttttgttaaaaaaaatgtatatttaaattcacagagggcatatcgccatgttttacttttaattttgttgcagtggctaagccgaaggcatgctctccagcagagggcacaacagggaataccagtctctgaatatggggtaagattttttgttcgttttcgctgctgattttgtccagtgaactgtcaatggtagacgtttgaaaaatatgaaactacagcattgcacgccctttttccatgcttgcctgttcaattcagtttgtgcagcttacttgtctcaactactagctttatatttaagtagggaggatttcaattttttttattgtcatcatctataggttttggttgacatgatccgtgtgcctgattgggcatttgaggccgttggcttggaaatgagaggaatgggccaagatactgcatatcatcctggtctttatttaacagctgcccaagtaagttgctttgcgcaatttgatgaatcgcctttcgacatatcgctagtgtgtgtgttgattgattctgttatttgcttatatttaggcatttagctgtacattcgattcaaggggtcgtactgtctgctagctgttggtataatctagctagacaaaatttccatgtatttatttgctagcgatctcagagatgcaaagaagtctctgaagacttctggatttgtattaaggagcaaaggtcagtacaaaacagagagtatgaggaatagaactcaatagaggcagtagaaaaggacaggaaagaaactaatactaattagcaaccacaatatttttgccccagcttgttgccaagcactggcagatctttttgtgataatctaactgagggtgatgtttcctgatcaaaggcatttagatacctttctttccaatgtttgcccaaatgcatgcatttgggaccattgttgaacactgcagtaacactgaaatccagtgtcattgagcagaatgattttaaattggtcctccttctgcagagagaggcagttgaggcactgattcaagaactcccgaagttcagactgaaagctgttcctacagactgcagtgagtgtccaatctgcctggaggaattccatgttggcaacgaggtaaattacagacaccaagtagagaacttgattgaactgcaattctactagtatttgcacatggtgcttcttcatgtgtttgtatgtggcatgaatccatcaggaaaaaagtccatttaacttattttgccagcaatcaactccctgaactatttcttttacccatttgatcccctaaactacatataaaaacagctcatcttgtttctttgtaacacatctcttttccgtctttatacaaggcatacttaagctaaaatttgtacaaccattgatgacaaaataaactactttacaaaatacttctatcatgaaattctgtatgcagtgttgaatctctatatttaaatttttatcttaggtgtgtctaacctatgcaaatagtgaacaaaaattcaaaaaaagaaaaaagagtaataatgtgtacatgccacaatttcaacgaagaatataacttgtataaagaataaaaaagcatggttagaagtaaagtggagcatttttgttagttcgagggtaaaacaagactagagatggtttatgaagttacgttctccagcatttttaaggactgacaaagacttcttttcccaatccattatgcaggtccgtgggctcccgtgcgcgcacaatttccatgtggagtgcatcgaccagtggctccggctgaatgtcaagtgcccccgttgccggtgctccgtcttccccaacctcgacctgagcgcgctcaacaacctccggccatcctccgagccggaccggccgtcggccagcgaggtgacagcggcgacgatggcgcggtacgtgaggtcgtcgcagccggctgggcagagctacctgctgcggctgcaggggctgctgctgcggcaggtggtggttcggcacggcggcggcgacgacatggcgagcgccgagaacggcgcttctcatgtggccgccgcggtgaccgcgccggcgaccaccggcggcgtggagagcgagctgcctagcatagtggttgacggtgggcatcagctgccggatcgctgaagcgcccggtggacggcgtgatgtagactgatagttatatgtgtggggaaggggaggatcgaagctatgcagcagcatgttttttttttctttgatcttatctcctgtgtgcagagtgtataaatattatgtaaaggagatcattattgcaagcttttgtttcccttt</dnaseqindica>

External Link(s)

NCBI Gene:Os05g0145000, RefSeq:Os05g0145000

  1. 1.0 1.1 1.2 1.3 1.4 Shuangcheng Li1, Wenbo Li1, Bin Huang1, et al.(2013)Natural variation in PTB1 regulates rice seed setting rate by controlling pollen tube growth.NATURE COMMUNICATIONS, DOI: 10.1038/ncomms3793.