AY986492

From RiceWiki
Revision as of 06:09, 28 May 2014 by Lishirong (talk | contribs)
Jump to: navigation, search

Function

Resistant and susceptible alleles of Xa27 encode identical proteins. However, expression of only the resistant allele occurs when a rice plant is challenged by bacteria harbouring avrXa27, whose product is a nuclear localized type-III effector. Induction of Xa27 occurs only in the immediate vicinity of infected tissue, whereas ectopic expression of Xa27 resulted in resistance to otherwise compatible strains of the pathogen. Thus Xa27 specificity towards incompatible pathogens involves the differential expression of the R gene in the presence of the AvrXa27 effector.


Expression

The Xa27(t) locus conferred a high level of resistance to 27 strains and moderate resistance to three strains. Resistance of the Xa27(t) gene was developmentally regulated in IRBB27 and showed semidominant or a dosage effect in the cv. CO39 genetic background. As a prelude to cloning Xa27(t), a molecular mapping strategy was employed with a large mapping population consisting of 3,875 gametes

Evolution

Induction of Xa27 occurs only in the immediate vicinity of infected tissue, whereas ectopic expression of Xa27 resulted in resistance to otherwise compatible strains of the pathogen. Thus Xa27 specificity towards incompatible pathogens involves the differential expression of the R gene in the presence of the AvrXa27 effector.

Structured Information

Gene Name

AY986492

Description

2361 bp DNA linear PLN 24-JUN-2005.

Definition

Oryza sativa (indica cultivar-group) Xa27 (Xa27) gene, Xa27-IRBB27

           allele, complete cds.
LocusTag

{{{tag}}}

Ensembl Transcript ID

{{{tid}}}

Ensembl Protein ID

{{{pid}}}

Length

2361 bp

Source

Oryza sativa Indica Group

ORGANISM Oryza sativa Indica Group

           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 6

Location

Chromosome 6:1558..1899

Sequence Coding Region

1558..1899

Genome Context

<gbrowseImage1> name=NC_008395:1558..1899 source=RiceChromosome06 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:1558..1899 source=RiceChromosome06 preset=GeneLocation </gbrowseImage2>

Coding Sequence

{{{CDNA}}}

Protein Sequence

<aaseq>MADWAMHHYLLLANQQRHRALADVAVRRRQLLLDSGRVFMLLGA

                    VILMHMLTTTGGGASSGCTRGAEPCVALLLWLLGAALAMLSLVAGRFPVLAAAIAEEL
                    GDHLLGGLWSL</aaseq>
Gene Sequence

<dnaseqindica>1 ctgcagctga accaaacagt tttagctcca tcgaagaaag gagttatact gattggaatg

      61 ctctcacagt aaaaaaaaca aggaagtaga gctggatttt agacagttct acaagaagtt
     121 agaactctac caaaattgga attttggatg atggtctttt aaaaactcga ttgcaggaat
     181 aaaattttac ggcttgaaac ttacaaaatg attagaaaag ataacatgcc tcagcgattt
     241 gtaaaaaagt gaacaaataa aaatctacaa taccactaaa ctattgcttt attttgggga
     301 cattgcttac cattgaaaaa acaactaacc gtaaatacga acacccatat caaatatact
     361 atcactgata aaataatcaa ttgtaaattc aagcacacat attagtatag tactttaact
     421 cgattggata gaagaaacct aactaattta agctatgcct cacaacaaaa aggtataaat
     481 tttttaaggc ttcttttttt ttcttgcgtt tgctagttta tgcttttaag atgtttatac
     541 cttttactcc cctcattcac tgtttaaata caatgggaat tagtgaaatc aatgagagtt
     601 caaacttcga aacactgaat acatgttatt ttggattgaa atcaaatcga atcagtcaaa
     661 ttcaaatagg aggaggaaca taggcattct tcctttcttc agcgggcacc attgaattca
     721 gatactgctt cgcctagtct ctgtccaaga ctccacattt tctgatggtg atggggaact
     781 ctgaaactat aggaggaaga ataaaatgaa gaatgcagaa atgaatagta atttgtgttt
     841 tttaattctt cttcaattcc accttaggat ccaacttcag tccaaatcca aagtaatgca
     901 actgccacta gatcaggcta gagcttcaaa ttcaactcca aaaacctccg taaagtggca
     961 cacacagagg aaaaatcctg gattcgtcac tgcccatcaa catctgcttt cgcctcccaa
    1021 ttcctgcttt ctgaaatctg ctttcgccga attcatgcct tcttgaatta tgctttctta
    1081 gaccctcttt agatgggact aaaactttta ctctctatca catcggatgt ttggacacta
    1141 attataaata ttaaacgtag actattaata aaacccatct ataatcttgt attaattcgc
    1201 gagacgaatc tattgagcct aattaatcca tgattagcct atgtgatgct ataataaaca
    1261 ttctctaatt ataaattaat tgggcttaaa aaatttgtct cgcgtattag ctttcattta
    1321 tataattagt tttataaata gtctatattt aatactctaa attagtgtct aaatacaggg
    1381 actaaagtta agtcactgga tccaaacacc acctaaggtt ttcttgtgta cttgtgaatt
    1441 gtggttgact acgactacta gtgctataaa tagaagaaga gacccataga gagcatcaga
    1501 gcaaagtact cctaaaagac agccacacac actgagacac ccaagaagct gcctccaatg
    1561 gcggattggg cgatgcacca ctacctccta ctagccaacc agcaacgcca ccgagccctc
    1621 gccgacgtcg ccgtccgccg ccgccagctg ctcctcgact ccggccgcgt cttcatgctc
    1681 ctcggcgccg tcatcctcat gcacatgctc accactaccg gcggcggagc atcgtccggc
    1741 tgcacccgcg gcgccgaacc ttgcgtcgcc ctcctcctgt ggctgctcgg cgcggcgctc
    1801 gccatgctgt cgctcgtcgc cggccgattc cccgttctcg ctgccgccat tgctgaggag
    1861 ctcggtgatc acctgcttgg tggtctctgg tctctctagt tctcctccgt gtccggtggt
    1921 catcttcttc tccgtgcttt tgctctggag ttgagtacgg atctgtgtgt actgcattct
    1981 tgcttaatta gtgccctaca cgttatgctt tcgaaacatc atcttttttc agtatagttc
    2041 aataaatttc agctcaaatt tgtcctccaa gacgagttct ccatccaaac gaaacttatg
    2101 gtgttccgtt gtttgggccg attttatatg ttggaaatgt acagacttca tagtactgtg
    2161 tttctttttt ggaataagtt caccagaggt tccttaactt aacggcgata tttttttagg
    2221 tcctttaacc acaaaaccag aaatgtgcac ccctaaactt tcacaatccg tgcacaagag
    2281 gtcctatggc agtatacgtg ggtggtttcg ctgacgtgac atcctagtca gcaaaaataa
    2341 ataaataagt aagtggggcc c</dnaseqindica>
External Link(s)

{{{Link}}}


Labs working on this gene

1. Temasek Life Sciences Laboratory, National University of Singapore, Singapore, 117604, Singapore

2. Rice Research Institute, Anhui Academy of Agricultural Sciences, Hefei, 230031, Anhui, China

2. Rice Research Institute, Anhui Academy of Agricultural Sciences, Hefei, 230031, Anhui, China


References

1. Yanchang Luo;Jatinder S. Sangha;Shouhai Wang;Zefu Li;Jianbo Yang;Zhongchao Yin

 Marker-assisted breeding of Xa4, Xa21 and Xa27 in the restorer lines of hybrid rice for broad-spectrum and enhanced disease resistance to bacterial blight
 Molecular Breeding, 2012, 30(4): 1601-1610

2. Keyu Gu;Bing Yang;Dongsheng Tian;Lifang Wu;Dongjiang Wang;Chellamma Sreekala;Fan Yang;Zhaoqing Chu;Guo-Liang Wang;Frank F. White;Zhongchao Yin

 R gene expression induced by a type-III effector triggers disease resistance in rice
 Nature, 2005, 435: 1122-1125

3. K.Gu;D.Tian;F.Yang;L.Wu;C.Sreekala;D.Wang;G.-L.Wang;Z.Yin

 High-resolution genetic mapping of Xa27(t), a new bacterial blight resistance gene in rice, Oryza sativa L.
 Theoretical and Applied Genetics, 2004, 108(5): 800-807