Os12g0476200

From RiceWiki
Revision as of 15:36, 28 May 2014 by Smallant (talk | contribs)
Jump to: navigation, search

Please input one-sentence summary here.


Xa25(Os01g0136400) is a new dominant gene for bacterial blight resistance in rice, which conferred resistance to Philippine race 9 (PXO339) of X.

Annotated Information

Function

The xa25, localized in the centromeric region of chromosome 12(see Fig. 1), mediates race-specific resistance to Xoo strain PXO339 at both seedling and adult stages by inhibiting Xoo growth.[1] This gene conferred resistance to Philippine race 9 (PXO339) of X. oryzae pv. oryzae in both seedling and adult stages.[2] It encodes a protein of the MtN3/saliva family, which is prevalent in eukaryotes, including mammals. Transgenic plants carrying dominant Xa25 was analysed for its responses to other Xoo strains at both seedling and adult stages. In seedling stage, the wild-type Minghui 63 carrying dominant Xa3/Xa26 and recessive xa25 was resistant to PXO339 and susceptible to PXO61, PXO341 and PXO99. The transgenic plants showed significantly increased susceptibility (P < 0.01) to PXO339 as compared with the wild-type and the susceptible control plants (Zhenshan 97) and had the same level of susceptibility to PXO61, PXO341 and PXO99 (see Fig. 2).[1] In the adult stage, the wild-type Minghui 63 was resistant to PXO339, moderately resistant to PXO61 and PXO341, and susceptible to PXO99 . Similar to the seedling stage, the transgenic plants only showed significantly increased susceptibility (P < 0.01) to PXO339 but not Xoo strains PXO61, PXO341 and PXO99 as compared with wild-type plants at adult stage (see Fig. 2). These results suggest that the recessive xa25 confers race-specific resistance to PXO339 at both seedling and adult stages. Location.jpg Function 2.jpg

Expression

Transformation of the dominant Xa25 into a resistant rice line carrying the recessive xa25 abolished its resistance to PXO339. The encoding proteins of recessive xa25 and its dominant allele Xa25 have eight amino acid differences. The expression of dominant Xa25 but not recessive xa25 was rapidly induced by PXO339 but not other Xoo strain infections. The nature of xa25-encoding protein and its expression pattern in comparison with its susceptible allele in rice–Xoo interaction indicate that the mechanism of xa25-mediated resistance appears to be different from that conferred by most of the characterized R proteins.

Evolution

Recessive xa25 belongs to the MtN3/saliva family


Recessive xa25 belongs to the MtN3/saliva family

Recessive xa25 belongs to the MtN3/saliva family


Characterization of more R genes against Xoo will facilitate evaluation of this inference.This gene localized in rice chromosome 12 and was tentatively named as Xa25(t) (Chen, Wang & Zhang 2002).



You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os12g0476200

Description

MtN3 and saliva related transmembrane protein family protein

Version

NM_001073287.2 GI:297613156 GeneID:4352201

Length

3215 bp

Definition

Oryza sativa Japonica Group Os12g0476200, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 12

Location

Chromosome 12:17446841..17450055

Sequence Coding Region

17448475..17448712,17448827..17448863,17449812..17449863

Expression

GEO Profiles:Os12g0476200

Genome Context

<gbrowseImage1> name=NC_008405:17446841..17450055 source=RiceChromosome12 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008405:17446841..17450055 source=RiceChromosome12 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggctggcctgtccctgcagcatccctgggcttttgccttcggcctccttggcaacctcatatccttcacgacctatctggcaccaatcccgacgttctaccggatctacaagagcaagtcgacggaggggttccagtcggtgccgtacgtggtggcgctcttcagcgccatgctgtggatcttctacgcgctgatcaagtccaacgaggccctcctcatcaccatcaacgccgccggttgcgtcatcgagaccatctacatcgtcatgtacctcgcctacgcccccaagaaggccaaggttcgatccatgtcatccaaaccctag</cdnaseq>

Protein Sequence

<aaseq>MAGLSLQHPWAFAFGLLGNLISFTTYLAPIPTFYRIYKSKSTEG FQSVPYVVALFSAMLWIFYALIKSNEALLITINAAGCVIETIYIVMYLAYAPKKAKVR SMSSKP</aaseq>

Gene Sequence

<dnaseqindica>1344..1581#1193..1229#193..244#aagagttttcagccaacacattgaactcttcttcagagctctcccttccctccacaaagggggtctagggttagagtgtgtgtgtctgtgacaagttccaagctagcaacaacaagctcaattccttgcttgtttgcttccatattacactacatctcttcccttcaattaccccccttttagcacacaaaaatggctggcctgtccctgcagcatccctgggcttttgccttcggcctccttggtatatcatcatcacctaccacaactaagacattcccttcattgccaacattttacttctttttattagaaaccattgagtttgtacatataagctcagagttattacttgctggcagatacgcatagctagcgacgacatttagtgaggattacactttagtggtcatcatatataaaataataaaattgttgtgtttctttatttgttttttattttctagctagcttctttcagttattttcaacaaaaagaatttcttctagcacttttatttacagcagtttattatgtctatttgggcatattaattagctactagcgcataagctaaaaaccctactagccttccgaaggcaatatggatggtactcttgtagtaataagccaaaagctagatttgattttttttatttcttttggcttttgtctattagaattatacgcgcggcgccacccttaaaattgcaggcttaaaatccacaagcatataaactacaagggcctaagcatacttaatgagatgcacatagccatataatttttctgcttcttgttaaactatatatatacagcaagtcctcatcatttgtatgtatatcctacttgtggagcaaacattcgatcctttggtgcaacctctatatatttatgttgccatggagagagagtggaattaataggtcaagctatatagtactctaattaatgacatcatagtgcaccatgtaacacaataatttaaagaacaagttaaaagccaaggcacaatctttgttgcaaaggaaggcaagggctagacataaagtttgtaaacgtgtctatctatcacaacttatcacgtctggtcgctaccttagctgcctccatggggctctttactcgcattactttgccttttttcctttacaaaatcctgatcttgtttctgttcctttggctttgcaggcaacctcatatccttcacgacctatctggcaccaatgtaagtaactgaatttctacatgatatatacatatatagcttttgtgtaattttaattcccaatccgcaccgcgttccgtatccgataatatatgtgcataatattttatgcagcccgacgttctaccggatctacaagagcaagtcgacggaggggttccagtcggtgccgtacgtggtggcgctcttcagcgccatgctgtggatcttctacgcgctgatcaagtccaacgaggccctcctcatcaccatcaacgccgccggttgcgtcatcgagaccatctacatcgtcatgtacctcgcctacgcccccaagaaggccaaggttcgatccatgtcatccaaaccctagcactaccacagaaaccctatttcgatgccggtggggacttgggaaccaccctttgattctcgagtcgcaaccggcaccgatgagaggccccttacaggtgtcatcggttgtgaacaagaaccggcacctatataagattgttccatatttaccgttttgtagtagtaaaatataataattgacaagtatatatggttcgacgtcgtttttgcaggtgttcacgacgaagatcctgctgctgctgaacgtgggggtgttcggggtgatcctgctgctgacgctgctgctctcccatggcgagcagcgcgtcgtctccctcggctgggtctgcgtcgccttctccgtcagcgtctttgtcgcgccgctcagcatcatcgtatgtgcatatatacgatcagtcgtcgtcaatctctagctagctcatctttacttcgtgtcttggtttgatcgatcgatctcgttgctaactgaactgcttccatggacgatggatgcgatattgcagaagcgagtgatccagtcgaggagcgtggagtacatgcccttctccctctccctcacgctcaccctcagcgccgtcgtctggttcctctacggccttctcatcaaggacaaatacgtcgcggtaattattcaatcaattacctaattatttcttcaaatcacaaactgctcaattcaaatttatgtgtgtgaccacatgaattgtaattaagctaaaattgtgtgaatttttgcagcttcccaacatcctgggcttcacattcggtgtggtccagatggggctctacgtgttctacatgaacgcgacgccggtggccggcgaggggaaagaagggaaggggaagctggcggcggcggaggagctccccgtcgtcgtcaacgtcggcaagctcgccgccgccacgcccgacaggagcaccggcgccgtgcacgtgcacccagtcccgaggagctgcgcggcggaggcggcggcggccgagccggaggtgctcgtcgacattccgccgccgccgccgccgcgcgccgtcgaggtggccgccgtgtagggtccccggccggtcaacgcgtgcttgcatgggccatgcacgtgtgcagtaccacgtgccacgtacactttaatatgaactccagggcaaacttggaggagacaagctaccaccaattaattaacttaattattattactcatctttcccaaaatataattacttttagcctctaaaatttatctcaaaatatagcaacttcttcacctatattctcttataaaacaatcgtaaccttccattaattaaatttcttacatatatatttctcctcttatcaatcaatcccaactgcctttttttttcattttattcctgtaactttcgtaatatatccgtatatcctatctaaaacttattatattttgggatggtgatggtattatatatctttcttgcatgccatgcaactagagacgggggaagctatgtgtaatgtatgtgcatgtgtttctctggtgttggtttccgcttctgttgtattcatttgtatcggtcaatgggtatctattattcctaattagttccttgtacttgtaatgtatgtcaaaattaataaaaatgtaatcgataaatatctcttct</dnaseqindica>

External Link(s)

NCBI Gene:Os12g0476200, RefSeq:Os12g0476200