Os01g0286100

From RiceWiki
Revision as of 09:15, 29 May 2014 by Tian-muer (talk | contribs)
Jump to: navigation, search

The OsPIL15 gene (Os01g0286100), a phytochromeinteracting factor-like protein gene, is a member of the rice Phytochrome‐interacting factors (PIFs) family, in regulating seedling growth.

Annotated Information

Nakamura et al.(2007) identified six phytochrome-interacting factor-like(PIL) homologs in rice, designated as OsPIL11 through OsPIL16. OsPIL15 contains six introns and encodes a predicted protein of 637 amino acids. Alignment using the amino acid sequence of the bHLH DNA domain revealed that OsPIL15 is highly similar to Arabidopsis PIF3 [1]. OsPIL15 encodes a basic helix‐loop‐helix factor localized in the nucleus.

Function

OsPIL15-OX seedlings exhibit an exaggerated shorter aboveground part and undeveloped root system relative to wild-type seedling. OsPIL15 represses a set of genes involved in auxin pathways and cell wall organization or biogenesis. Exposure to red light or far‐red light relieved growth retardation and promoted seedling elongation in the OsPIL15-OX lines. The results suggest that light regulation of OsPIL15 expression is probably involved in photomorphogenesis in rice[2].

In addition, OsPIL13 and OsPIL15 colocalize with OsPRR1, an ortholog of the Arabidopsis APRR1 gene that controls photoperiodic flowering response through clock function. Overexpression of OsLF might repress expression of OsGI and Hd1 by competing with OsPRR1 in interacting with OsPIL13 and OsPIL15 and thus induce late flowering[3].

Expression

OsPIF15 gene is widely expressed in leaves, roots, stems, young spike, spike, old embryos and other tissues. The expression level in the leaves is significantly higher than other tissues, especially in the flag leaf. The xpression of OsPIF15 gene is regulated by development and is closely related to phyB.

Evolution

The OsPIL15-OX lines: To construct the OsPIL15-overexpression vector, the ORF region of OsPIL15 was amplified by PCR from its full length cDNA clone J033088H. The primer pair used for the amplification and introduction of the restriction sites was 5’‐AAACTAGTATGTCCGACGGCAACGAC‐3’ (SpeI site underlined) and 5’ ‐ATGGTCACCTTATGTTTCAGCCCCATCTC‐3’ (BstEII site underlined). The resulting PCR product was digested with SpeI and BstEII and subcloned into the p1390‐Ubi vector between the maize ubiquitin promoter and the nos terminator. The plasmid was introduced into Agrobacterium tumefaciens strain EHA105[4] by electroporation[2].

Labs working on this gene

·Shandong Rice Research Institute, Shandong Academy of Agricultural Sciences, Jinan 250100, China

·Laboratory of Molecular Microbiology, School of Agriculture, Nagoya University, Chikusa-ku, Nagoya 464-8601, Japan

·National Key Laboratory of Plant Molecular Genetics, Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, 300 Fenglin Road, Shanghai 200032, China

References

[1] Nakamura Y, Kato Y, Yamashino Y, Murakami M, Mizuno T. Characterization of a set of phytochrome‐interacting‐factor‐like bHLH proteins in Oryza sativa. Biosci Biotech Biochem, 2007(71): 1183-1191.

[2] Zhou J, Liu Q, Zhang F, Wang Y, Zhang S, Cheng H, Yan L, Li L,Chen F, Xie X. Overexpression of OsPIL15, a phytochromeinteracting factor‐like protein gene, represses etiolated seedling growth in rice. Journal Of Integrative Plant Biology, 56: 373-387.

[3] Zhao XL, Shi ZY, Peng LT. An atypical HLH protein OsLF in rice regulates flowering time and interacts with OsPIL13 and OsPIL15. New Biotechnology, 2011(28): 788-797.

[4] Hood E, Gelvin S, Melchers L, Hoekema A. New Agrobacterium helper plasmids for gene transfer to plants. Transgenic Res, 1993, 2:208-218.

Structured Information

Gene Name

Os01g0286100

Description

Basic helix-loop-helix dimerisation region bHLH domain containing protein

Version

NM_001049310.1 GI:115436033 GeneID:4327916

Length

3148 bp

Definition

Oryza sativa Japonica Group Os01g0286100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:10319113..10322260

Sequence Coding Region

10319429..10319542,10319639..10320124,10320218..10320283,10320371..10320436,10320598..10320690
,10320781..10321867,10321976..10321977

Expression

GEO Profiles:Os01g0286100

Genome Context

<gbrowseImage1> name=NC_008394:10319113..10322260 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:10319113..10322260 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtccgacggcaacgacttcgccgagctgctgtgggagaacggccaggcggtggtgcacgggaggaagaagcacccgcagccggccttcccgccgttcggcttcttcggtggcaccggcggtggcggcggcggcagcagtagtagagcccaggagaggcagcccggcggcatcgatgcgttcgccaaggtggggggcggcttcggcgccttgggcatggctccggcggtgcacgacttcgcttctggcttcggcgccaccacgcaggacaacggtgatgatgacaccgttccgtggatccattaccccataattgacgatgaagacgccgccgcccctgctgctctcgcagcagcggactatggctccgacttcttctccgagctccaggcggcggcggctgccgcggcggccgccgcgccgccgaccgatctcgcctctctgccagcctccaatcacaacggcgccaccaataacagaaatgctccggttgccaccaccaccaccagggaaccctccaaggaaagccacggcggcctgtcggttcccaccacccgagccgagccgcagccgcagccacagctcgccgcagccaagctgcctcggtcgagcggcagcggcggcggcgagggcgtgatgaacttctcgctcttctcccgcccggccgtcctggcgagggcgacgctggagagcgcgcagaggacgcagggcaccgacaataaggcgtccaatgtcaccgcgagcaaccgcgtcgagtcgacggtcgtgcagacggcgagcgggccaaggagcgcaccggcgttcgccgatcagagggcggcggcgtggccgccgcagccgaaggagatgccgttcgcgtccacggcagccgctcccatggccccggccgttaacctgcaccacgagatgggccgtgacagggcaggccgaaccatgcctgtccacaaaaccgaggcgaggaaggcacctgaggccacggtcgcgacatcgtcggtgtgctccggcaacggagctgggagtgacgagctgtggcgccagcagaagcggaagtgccaggcccaggcagagtgctcagctagccaagacgatgatcttgacgatgaacctggagtattgagaaaatctggaaccaggagcacgaaacgcagccgcacagctgaggttcacaatttatcagaaaggaggagaagggacaggatcaatgaaaagatgcgcgctctgcaagaactcattcccaactgcaacaagattgataaagcctcgatgctggatgaagctatagagtacctcaaaacccttcagcttcaagtacagatgatgtccatgggaactgggctgtgcattcctccaatgctattaccaacagccatgcagcacttgcaaattccaccgatggctcatttccctcatctcggcatgggattggggtacgggatgggcgtcttcgacatgagcaacactggagcacttcagatgccacccatgcctggtgctcactttccctgcccaatgatcccaggtgcgtcaccacaaggtcttgggatccctggcacaagcaccatgccaatgtttggggttcctgggcaaacaattccttcgtcagcgtctagtgtaccaccatttgcatctttggctggtcttcctgttaggccaagcggggtccctcaagtatcaggcgccatggctaacatggtgcaagaccagcaacaaggcatagcgaatcaacagcagcaatgtctgaacaaggaagctatacagggagcaaatccaggtgattcacaaatgcagatcatcatgcagggtgacaacgagaattttaggataccctcttcagcccaaacaaaaagcagtcaattttcagatggtaccggcaaggggaccaacgctagagagagagatggggctgaaacataa</cdnaseq>

Protein Sequence

<aaseq>MSDGNDFAELLWENGQAVVHGRKKHPQPAFPPFGFFGGTGGGGG GSSSRAQERQPGGIDAFAKVGGGFGALGMAPAVHDFASGFGATTQDNGDDDTVPWIHY PIIDDEDAAAPAALAAADYGSDFFSELQAAAAAAAAAAPPTDLASLPASNHNGATNNR NAPVATTTTREPSKESHGGLSVPTTRAEPQPQPQLAAAKLPRSSGSGGGEGVMNFSLF SRPAVLARATLESAQRTQGTDNKASNVTASNRVESTVVQTASGPRSAPAFADQRAAAW PPQPKEMPFASTAAAPMAPAVNLHHEMGRDRAGRTMPVHKTEARKAPEATVATSSVCS GNGAGSDELWRQQKRKCQAQAECSASQDDDLDDEPGVLRKSGTRSTKRSRTAEVHNLS ERRRRDRINEKMRALQELIPNCNKIDKASMLDEAIEYLKTLQLQVQMMSMGTGLCIPP MLLPTAMQHLQIPPMAHFPHLGMGLGYGMGVFDMSNTGALQMPPMPGAHFPCPMIPGA SPQGLGIPGTSTMPMFGVPGQTIPSSASSVPPFASLAGLPVRPSGVPQVSGAMANMVQ DQQQGIANQQQQCLNKEAIQGANPGDSQMQIIMQGDNENFRIPSSAQTKSSQFSDGTG KGTNARERDGAET</aaseq>

Gene Sequence

<dnaseqindica>2719..2832#2137..2622#1978..2043#1825..1890#1571..1663#394..1480#284..285#aggtccccccacgccacagcctcttatcccacacgcggaccaacagcgccgccccgcccgtcccccgcttcaccttcggcttcgacttcggcttcgtttcctcttctcttcgtctctccctccctccagcgaaagaaagagagagctcacctcgcgttgcccggccggccgcggaggagagcacggcttcgcattcggctggagctctcgtctctgcactcggagtacagctgcaaactcctccttccttgatttcttcaccctgtctccacggactgcacagatgtgggtgcaacgcgatctttcgctgcctccggtttagctctccggttgattccgatcgaggaagctgatgcatgtgtttgtatatggctcggtgttttgtgtgtgcaggtccgacggcaacgacttcgccgagctgctgtgggagaacggccaggcggtggtgcacgggaggaagaagcacccgcagccggccttcccgccgttcggcttcttcggtggcaccggcggtggcggcggcggcagcagtagtagagcccaggagaggcagcccggcggcatcgatgcgttcgccaaggtggggggcggcttcggcgccttgggcatggctccggcggtgcacgacttcgcttctggcttcggcgccaccacgcaggacaacggtgatgatgacaccgttccgtggatccattaccccataattgacgatgaagacgccgccgcccctgctgctctcgcagcagcggactatggctccgacttcttctccgagctccaggcggcggcggctgccgcggcggccgccgcgccgccgaccgatctcgcctctctgccagcctccaatcacaacggcgccaccaataacagaaatgctccggttgccaccaccaccaccagggaaccctccaaggaaagccacggcggcctgtcggttcccaccacccgagccgagccgcagccgcagccacagctcgccgcagccaagctgcctcggtcgagcggcagcggcggcggcgagggcgtgatgaacttctcgctcttctcccgcccggccgtcctggcgagggcgacgctggagagcgcgcagaggacgcagggcaccgacaataaggcgtccaatgtcaccgcgagcaaccgcgtcgagtcgacggtcgtgcagacggcgagcgggccaaggagcgcaccggcgttcgccgatcagagggcggcggcgtggccgccgcagccgaaggagatgccgttcgcgtccacggcagccgctcccatggccccggccgttaacctgcaccacgagatgggccgtgacagggcaggccgaaccatgcctgtccacaaaaccgaggcgaggaaggcacctgaggccacggtcgcgacatcgtcggtgtgctccggcaacggagctgggagtgacgagctgtggcgccagcagaagcggaagtgccaggcccaggcagagtgctcagctagccaagacgatgtaagtaaatggtatgagatagatatgcactgcataaccagctgactataccttcgctgattctcatgataaaaaactggttctattcaggatcttgacgatgaacctggagtattgagaaaatctggaaccaggagcacgaaacgcagccgcacagctgaggttcacaatttatcagaaagggtgagtagctcacatcttcagtgcatggatcatcctgcatccatttgcttcaaagttcacatgtcagtgcattgatcatcctgcatccatttgcttcaatcccatgactcgactcatgctgcaattttattgactgtattgcaacccaacaatctttgcagaggagaagggacaggatcaatgaaaagatgcgcgctctgcaagaactcattcccaactgcaacaaggtaaagataagccattccatcgtcttgctccctctgagatgcctctgaatgaacatttggtcaattcaggcatgctatgttttgcagattgataaagcctcgatgctggatgaagctatagagtacctcaaaacccttcagcttcaagtacaggtacattgaaactgccttcgaacaaatgtaccatgattgtcgggtgaatatgtacatagatgcattgacaaggtgcagttgtcattgacacagatgatgtccatgggaactgggctgtgcattcctccaatgctattaccaacagccatgcagcacttgcaaattccaccgatggctcatttccctcatctcggcatgggattggggtacgggatgggcgtcttcgacatgagcaacactggagcacttcagatgccacccatgcctggtgctcactttccctgcccaatgatcccaggtgcgtcaccacaaggtcttgggatccctggcacaagcaccatgccaatgtttggggttcctgggcaaacaattccttcgtcagcgtctagtgtaccaccatttgcatctttggctggtcttcctgttaggccaagcggggtccctcaagtatcaggcgccatggctaacatggtgcaagaccagcaacaaggcatagcgaatcaacagcagcaatgtctgaacaaggaagctatacagggagcaaatccaggtgattcacaaatgcagatcatcatgcaggtactaattaaaaattaacaaatgatgtcaagcgaatagaagacatttgctagtacttaagtgcattacttactccagtttattttaatattccagggtgacaacgagaattttaggataccctcttcagcccaaacaaaaagcagtcaattttcagatggtaccggcaaggggaccaacgctagagagagagatggggctgaaacataaagaaaggccagtaggtgtaacttgactttcatgctaaatttgagatctaccactgaaatctgcagaatgttcctgtcctaaaaagatcaatggctgaggaatttcatgtacgaccaactaacaacttccagatatgaaagttagcaattcatactgggagaacttacttgagtatcaagatccacgaggcagatgtatcagccaagatgccccaaaattttgtgtaaaatgtagatggtagaagatgctaccaggttacaagctgtaattcttgacttccagtgcagtttcctatgagtagtttttgccctatctg</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0286100, RefSeq:Os01g0286100