Os10g0478000

From RiceWiki
Revision as of 04:18, 30 May 2014 by Chenyaping (talk | contribs) (Function)
Jump to: navigation, search
The rice TAWAWA1 (TAW1) gene, a member of ALOG family, was identified as a  regulator of rice inflorescence architecture.

Annotated Information

Function

Fig 1. Characterization of taw1 dominant mutants [1].
Fig 2. Isolation of the TAW1 gene [1].
Fig 3. Expression pattern of TAW1 [1].
Fig 4. SVP subfamily MADS-box genes work downstream of TAW1 [1].
Fig 5. Phenotype of taw1-D2–introgressed Koshihikari BC5F2 plants [1].

In the dominant gain-of-function mutant tawawa1-D, the activity of the inflorescence meristem (IM) is extended and spikelet specification is delayed, resulting in prolonged branch formation and increased numbers of spikelets. In contrast, reductions in TAWAWA1 (TAW1) activity cause precocious IM abortion and spikelet formation, resulting in the generation of small inflorescences. TAW1 encodes a nuclear protein of unknown function and shows high levels of expression in the shoot apical meristem, the IM, and the branch meristem (BMs). TAW1 expression disappears from incipient spikelet meristems (SMs). It is demonstrated that members of the SHORT VEGETATIVE PHASE subfamily of MADS-box genes function downstream of TAW1.Thus, TAW1 is proposed as a unique regulator of meristem activity in rice and regulates inflorescence development through the promotion of IM activity and suppression of the phase change to SM identity [1].

Expression

Please input expression information here.

Evolution

TAW1 function might have evolved to ensure the production of sufficient numbers of spikelets. Unraveling the molecular function of TAW1 will provide an opportunity for a greater understanding of meristem activity and identity, which is a fundamental issue in plant biology. Furthermore, such knowledge could be exploited to further increase crop yields. In addition, TAW1 is of great interest with respect to the evolution of inflorescence architecture. TAW1 function may be essential for the development of compound inflorescences, in which the branching pattern is crucial [1].

Labs working on this gene

  • Graduate School of Agriculture and Life Sciences, The University of Tokyo, Yayoi, Bunkyo, Tokyo 113-8657, Japan

References

<references> [1]

Structured Information

Gene Name

Os10g0478000

Description

Protein of unknown function DUF640 domain containing protein

Version

NM_001189280.1 GI:297727690 GeneID:9266624

Length

1426 bp

Definition

Oryza sativa Japonica Group Os10g0478000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:18345508..18346933

Sequence Coding Region

18345710..18346324

Expression

GEO Profiles:Os10g0478000

Genome Context

<gbrowseImage1> name=NC_008403:18345508..18346933 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:18345508..18346933 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggagttcgtggcgcacgcggcggcgccggacagcccgcactcggacagcggcggaggaggagggggaatggcgacgggggcgacgtcggcgtcggcggcgggggcgtcgccgagcaggtacgagtcgcagaagcggcgggactggaacacgttcgggcagtacctccgcaaccaccggccgccgctgtcgctggcgcggtgcagcggcgcgcacgtcctggagttcctccgctacctggaccagttcggcaagaccaaggtgcacgcgccggcgtgccccttcttcggccacccggcgccgccggcgccgtgcccgtgcccgcttcgccaggcgtggggcagcctcgacgccctcgtcggccgcctccgcgccgcctacgaggagaacggcggccgccccgagaacaaccccttcggcgcccgcgccgtccgcctctacctccgcgaggtccgcgagcaccaggcgcgcgcacgcggcgtcagctacgagaagaagaagcgcaagaagccaccccacccctcctccgccgccgccgcgcacgacgacgccgccaacggcgccctccaccaccaccaccacatgccgccgcctcctcccggcgccgccgcctga</cdnaseq>

Protein Sequence

<aaseq>MEFVAHAAAPDSPHSDSGGGGGGMATGATSASAAGASPSRYESQ KRRDWNTFGQYLRNHRPPLSLARCSGAHVLEFLRYLDQFGKTKVHAPACPFFGHPAPP APCPCPLRQAWGSLDALVGRLRAAYEENGGRPENNPFGARAVRLYLREVREHQARARG VSYEKKKRKKPPHPSSAAAAHDDAANGALHHHHHMPPPPPGAAA</aaseq>

Gene Sequence

<dnaseqindica>610..1224#tatcggctccttctcgcccagcttttgctcacgtcacatcaccttccacctccacccctccactcgctcgctcgcttgcttgctccaattaatacctcttctccttctcccccagcaactagcttccttctccgcttttgcagctcgccgccgccgccgccgccgccgccgcgacacggcgcgcatatggtcgtcgtcgtcgtcgtcgtcgtcgctggagaagacgaagaaagatagtagacctgagctgggggggcggtgaattcgccggagagctagctaaggtgagtttcgttttcggtttcggtttcgatcgatttgttggtgcagatgcatctgggagctagagaactatttatagtggctgcggtgcggtgcggcgtcgccacgccgcgcacgcgctcgcccacgtcgcgcgcgcgcgggcgcgcgtccactctctctctctcttggaccactgcgcgcgcgggcgcgcgtcggcgtcgccacggcttctcaagaacgcgcgcgcgcgcactgattcccagatagatagatctatatctgttcgtcttcctcagctatggtgtggtggtggtggtggtgtttgtggtgttgtgcagatcgacgatggagttcgtggcgcacgcggcggcgccggacagcccgcactcggacagcggcggaggaggagggggaatggcgacgggggcgacgtcggcgtcggcggcgggggcgtcgccgagcaggtacgagtcgcagaagcggcgggactggaacacgttcgggcagtacctccgcaaccaccggccgccgctgtcgctggcgcggtgcagcggcgcgcacgtcctggagttcctccgctacctggaccagttcggcaagaccaaggtgcacgcgccggcgtgccccttcttcggccacccggcgccgccggcgccgtgcccgtgcccgcttcgccaggcgtggggcagcctcgacgccctcgtcggccgcctccgcgccgcctacgaggagaacggcggccgccccgagaacaaccccttcggcgcccgcgccgtccgcctctacctccgcgaggtccgcgagcaccaggcgcgcgcacgcggcgtcagctacgagaagaagaagcgcaagaagccaccccacccctcctccgccgccgccgcgcacgacgacgccgccaacggcgccctccaccaccaccaccacatgccgccgcctcctcccggcgccgccgcctgagccgagccgagcttgctccaagatcgccggaaaacgagctgctagcctcctacgcatgcactagttactccactccactccactccactatgatccctagctaggctgctcttgctactagcaaaactacggattaatctccatgcttgctactgctgctgctgctgctactgcatctaattaattaggttgattatttcct</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0478000, RefSeq:Os10g0478000

  1. 1.0 1.1 1.2 1.3 1.4 1.5 1.6 1.7 Yoshida A, Sasao M, Yasuno N, et al. (2013) TAWAWA1, a regulator of rice inflorescence architecture, functions through the suppression of meristem phase transition. Proceedings of the National Academy of Sciences 110: 767-772.