Os03g0315400

From RiceWiki
Revision as of 06:55, 30 May 2014 by Liuq036 (talk | contribs) (Expression)
Jump to: navigation, search

Its gene name OsMYB2, is a R2R3-type MYB gene, expression a MYB-type transcription factor plays a important role in the tolerance to abiotic stress of plants.

Annotated Information

Function

1、Overexpression of OsMYB2 enhanced tolerance to salt cold, and dehydration stress(figure 1).

The tolerance to abiotic of overexpression and RNAi of OsMYB2.jpg

WT:wildtype; OE2 and OE3: OsMYB2 overexpression strain; Ri1 and Ri3: OsMYB2 RNAi strain;

2、Overexpression of OsMYB2 altered sensitivity of seed germination and growth to salt stress and ABA(figure 2).

Responses of seed germination and seedling growth to treatment with NaCl and abscisic acid (ABA).jpg

3、OsMYB2-overexpression plants accumulated greater amount of proline and soluble sugars(figure 3).

Effect of salt stress on contents of proline and soluble sugars and gene expression in wild-type and transgenic rice plants.jpg

4、OsMYB2-overexpression plants accumulated less H2O2 and MDA under salt stress(figure 4).

Effect of salt stress on contents of oxidants (A and B) and antioxidant enzymes (C–D) in wild-type and transgenic rice plants.jpg

5、OsMYB2-overexpression plants affect some genes' expression profiles. Some genes upregulation can contribute to enhanced tolerance of plants to salt stress and some may involved in stress response.

Expression

OsMYB2 was detected in roots,shoots,leaves, and flowers, but it was specifically located in the nucleus(figure 5)

Subcellular localization of OsMYB2.jpgThe response of OsMYB2 expression to salt, cold, and dehydration stress was monitored by real-time RT-PCR. An increase in the OsMYB2 transcript was observed after 30 min of exposure to salt stress. The salt stress-induced increase in the OsMYB2 transcript peaked after 5 h of salt stress, and thereafter the transcript declined gradually under salt stress . A similar increase in the OsMYB2 transcript was also observed when rice seedlings were exposed to low temperature (2�℃) or osmotic stress (20% PEG) . In addition, treatment of rice seedlings with ABA also led to an increase in expression of OsMYB2. In contrast,

exogenous application of salicylic

acid reduced the expression of OsMYB2, while no effect of indoleacetic acid and brassinosteroids on the OsMYB2 transcript was observed. OsMYB2 was detected in roots, shoots, leaves, and flowers under non-stressed conditions, with the expression being greatest in leaves, followed by roots and shoots . The strong induction of this gene by abiotic stress prompted this study to check its promoter sequence (1500 bp upstream from the transcription start site) by searching the promoter sequence against the PLACE database [(http://www.dna.affrc.go.jp/PLACE/)]. The promoter of OsMYB2 contains stress-responsive related cis-elements, such as ABRE and MYB and MYC recognition sites

a、b、c: localization of GFP ; e、d、f:localization of GFP-OsMYB2

Evolution

Phylogenetic tree of MYB proteins(figure 6).


Phylogenetic tree of MYB proteins.jpg

OsMYB2 representative by LOC_Os3g20090 is belong to C12, and of which are involved in stress response.

Labs working on this gene

1 State Key Laboratory of Vegetation and Environmental Change, Institute of Botany, the Chinese Academy of Sciences, Beijing 100093, PR China

2 Graduate University of the Chinese Academy of Sciences, Beijing 100049, PR China

References

A R2R3-type MYB gene, OsMYB2, is involved in salt, cold, and dehydration tolerance in rice.An Yang1,2, Xiaoyan Dai1 and Wen-Hao Zhang*,1.Journal of Experimental Botany, Vol. 63, No. 7, pp. 2541–2556, 2012.

Structured Information

Gene Name

Os03g0315400

Description

Similar to Typical P-type R2R3 Myb protein (Fragment)

Version

NM_001056472.1 GI:115452672 GeneID:4332651

Length

2127 bp

Definition

Oryza sativa Japonica Group Os03g0315400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:11376759..11378885

Sequence Coding Region

11377201..11378033,11378520..11378676

Expression

GEO Profiles:Os03g0315400

Genome Context

<gbrowseImage1> name=NC_008396:11376759..11378885 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:11376759..11378885 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtga</cdnaseq>

Protein Sequence

<aaseq>MDMAHERDASSEEEVMGGDLRRGPWTVEEDLLLVNYIAAHGEGR WNSLARSAGLKRTGKSCRLRWLNYLRPDLRRGNITPQEQLLILELHSRWGNRWSKIAQ HLPGRTDNEIKNYWRTRVQKHAKQLKCDVNSQQFKDVMRYLWMPRLVERIQAAAAGQQ QQQEGGTDTPPLSWQHGGSDGLYESPELPAPDASCWPAEYCAAAGGAQSGGTPAPELS STTAGSSSLSTDSGAGAQPSWPTQADGAEWFTTACDASSATGGVAMRDTELELAQPPC QGGQTWTTSESSLPGLTFPDLAVADFEIGGFDVDSFWTSMEDDQLWCPTQAAV</aaseq>

Gene Sequence

<dnaseqindica>853..1685#210..366#agtttcatcgcagcacacatccatccatccatccatctatccagagagcacagcaacggcgcatatatagtacccctctaccaaagcacaacaaccagaatctcctgagctcgatctagctactagcttgatctatccgatcaatcgactggcccgcgaggatcgatcgagactcgaaagggagggattttgatccggatcggtcgacgatggacatggcgcacgagagggacgcgagcagcgaggaggaggtgatgggcggcgacctgcgtcgcgggccgtggacggtggaggaggacctcctgctcgtcaactacatcgccgcgcacggcgagggccgctggaactcgctcgcccgatcagcaggtaggatcgcgatctcgatcgatcgagctcccaattccaccataaattacatgcacgcacacatcgatcaattccatgagctgagtgtccgtacatgcttagcctgatgagcaattataggacgcaaagtaccagtcgctcttgcatctacatgctgatttctggaaacacagatagctacgagtctaccctgagttctctagcagccaaccagctaagctagaagctatagtgagtgagagggaaaggggagagaatttttagtggttagcagcgtagctagcattgttcatagggatatttttagttgctcatccctcccccgttacatcatccatcctgccgtcgtcgtatgcgtataactgcattagtatataattgattagttgctgcatactatgttttagcaatggtgtactacatgtgaatattttgatgtgacgtgaagagaaaaattaatcttggtttttggttgttgtcatgcagggctgaaacgcacaggcaagagctgccggctccggtggctgaactacctccgccccgacctccggcgaggcaacatcacgccgcaggagcagctgctcatcctggagctgcactcgcggtggggaaaccgctggtccaagatcgcgcagcacctcccgggacgcaccgacaacgagatcaagaactactggcgcacgcgggtgcagaagcacgccaagcagctcaagtgcgacgtcaacagccagcagttcaaggacgtcatgcgctacctctggatgccccgcctcgtcgagcgcatccaggccgccgccgccgggcagcagcagcagcaggaaggcggcaccgacacgccgcccctgtcgtggcagcacggcggctccgacgggctctacgagtcgccggagctcccggcgcccgatgccagctgctggccagccgagtactgcgcggcggccggcggcgcgcagtcgggcggcacgcctgcaccggagctgtcgagcaccacggccgggtcgtcgtcgctgtccacggactccggcgccggggcgcagcccagctggcccacgcaggccgacggcgccgagtggttcaccaccgcctgcgacgcctccagcgccaccggcggcgtggccatgcgcgacacggagctggagctggcccagccgccgtgccagggcgggcagacgtggacgacgtccgagtcgtcgctgcctggcctcaccttccccgacctcgccgtcgcggacttcgagatcggcggcttcgacgtcgatagcttctggacgagcatggaggacgaccagctgtggtgccccacccaggccgccgtgtgaaaagtcagcacggccgccatgggaatccgccgcggcgagcgagcgcgcgcgcgcgcgacacccgcgggtgcacaaccgccggggacgcgtagcggagcggagaagcggattagaagaaggagagaagctatctgggggattagaacaagattaatcgcctcacgatgccatttttggactcctagctcccagactattctaactccagttcttttccgtttctttctccttttttacttcctagggtaaaaaaaaagaagttaaagtgtagccgttatactagtgttgatgctgctgttactaaagtttgtccgttaaattttactcattctttttgagtaaatacagtactgccactactgtatgtacgagctgaactctgtaggattgacaggattactgtacacttctagaaaccggtaataaaagcaaagctccgacg</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0315400, RefSeq:Os03g0315400