Os01g0257300
Please input one-sentence summary here.
Contents
Annotated Information
Function
OsRAA1 encodes a 12.0-kD protein that has 58% homology to the AtFPF1 (Flowering Promoting Factor 1) in Arabidopsis, which has not been reported as modulating root development yet.OsRAA1 Regulates Primary Root Development by Modulating Mitosis.OsRAA1 Interacts with OsRPT4 and Functions in Sister Chromatid Separation in Rice Root Cells.OsRAA1 was degraded by the 26S proteasome through interaction with OsRPT4,and APC perhaps serves to recognize OsRAA1 as E3.
Expression
Please input expression information here.
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
- OsRAA1 Interaction Protein Screening
- OsRAA1 Interacts with OsRPT4 in Vitro and in Vivo
- Aberrant Mitosis Occurs in OsRAA1 Transgenic Rice and Transgenic Yeast Cells
- Degradation of OsRAA1 Depends on the Proteasome
- Two-Hybrid cDNA Library Construction and Screening
- Protein Deletion Mutation and Yeast Plasmid Construction
- Pull-Down Assay
- Immunofluorescence of Rice Root Tips
- Coimmunoprecipitation and Tris-Tricine Gel Electrophoresis
- Colocalization of OsRAA1 and Tubulin in the BY-2 Cell Line
- Transient Subcellular Localization
- Determination of the Half-Life of OsRAA1
- Protein Degradation Assay in Vitro
- Morphological Examination of Transformed S. pombeCells
References
Please input cited references here.
- Rice ROOT ARCHITECTURE ASSOCIATED1 Binds the Proteasome Subunit RPT4 and Is Degraded in a D-Box and Proteasome-Dependent Manner Plant Physiology, 2008, 148(2): 843-855
- Overexpression of OsRAA1 Causes Pleiotropic Phenotypes in Transgenic Rice Plants, including Altered Leaf, Flower, and Root Development and Root Response to Gravity Plant Physiology, 2004, 135(3): 1502-1513
Structured Information
| Gene Name |
Os01g0257300 |
|---|---|
| Description |
Conserved hypothetical protein |
| Version |
NM_001049166.1 GI:115435745 GeneID:4326229 |
| Length |
785 bp |
| Definition |
Oryza sativa Japonica Group Os01g0257300, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 1:8585137..8585921 |
| Sequence Coding Region |
8585497..8585826 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008394:8585137..8585921 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008394:8585137..8585921 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaa</cdnaseq> |
| Protein Sequence |
<aaseq>MSGVWVFKNGVVRLVEKQQATAGTAVAGGRRKALVHTPSGQVVS SYAALEARLTALGWERYYEDPSLFQFHKRGSLDLISLPADFSAFSSVHMYDIVVKNRD SFRVVDA</aaseq> |
| Gene Sequence |
<dnaseqindica>96..425#tccatccacccatagctatctctagctagcttgcacattcttcattcttcttgcaatcagagctagagaaaaagagtttgagagagatctaagagatgtcaggggtttgggtgttcaagaacggggtggtgagattggtggagaagcagcaggcgacggcggggacggcggtggcgggagggaggaggaaggcgctggtgcacacgccgagcgggcaggtggtgtcgtcgtacgcggcgctggaggcgcggctgacggcgctcgggtgggagcgctactacgaggacccctccctcttccagttccacaagcgtggctccctcgacctcatctccctccccgccgacttctccgccttctcctccgtccacatgtacgacatcgtcgtcaagaaccgcgactccttccgcgtcgtcgacgcctaaattgacctatgtataggctcgcatgcatgcaaggtagacgaccatccaccttgcatgcatgcaggctatcattctctcttcgtctccgtcttcgtctttcatctttgttgtggtgtgtgtgaatttattatacttcttatgactgtgtgtgtgactgtgtgagagttcatggagagtgatgagtagtggtatacatatgtgtcgtcgctgatcgatttggtttattaccttgtgggtgggtattaattatcagcagtgtgttatatcaattgcttacttgtatgtgtatcatgtacatgagtgagtgtggctgatgcatatatatagaggtctttaataattatgtactatatatttgtg</dnaseqindica> |
| External Link(s) |