Os08g0499300

From RiceWiki
Revision as of 04:59, 31 May 2014 by Zhong6937991 (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Fig.1 A representative photograph taken at twelve days after inoculation. OsWRKY30OX plants show enhanced resistance to Xoo.
Fig.2 Disease symptoms in wild-type (WT) and WRKY30 overexpression (lines 2-3 and 17-2) plants at 7 days after inoculation (DPI) with Rhizoctonia solani.
Fig.3 Overexpression of OsWRKY30 in rice exhibited more tolerance to water deficit stress than did wild type plants.

OsWRKY30 encodes a protein named WRKY30 transcription factor, which is a member of Group Ia of rice WRKY family with two DNA-binding domains, designated the WRKY domain, containing a highly conserved WRKYGQK residue as well as a novel zinc finger motif. Both the conserved elements of the domain are necessary for high binding affinity of WRKY30 to a canonical W-box containing a sequence of TTGACC/T [1][2].

WRKY30 is rapidly induced by pathogen M. grisea infection, bacterial pathogen Xanthomonas oryzae pv. oryzae (Xoo) and related phytohormones SA and JA [2].OsWRKY30 functions as a positive regulator of rice disease resistance via an SA signaling pathway. It can up-regulate the SA-responsive gene OsWRKY45[3]. WRKY30 is also associated with activated expression of JA synthesis-related genes LOX, AOS2 and pathogenesis-related (PR)3 and PR10, and increased endogenous JA accumulation under the challenge of fungal pathogens[4].

OsWRKY30 is also involved drought tolerance. OsWRKY30 interacts with the rice mitogen-activated protein kinases(MAPKs), OsMPK3, OsMPK4, OsMPK7, OsMPK14, OsMPK20-4 and OsMPK20-5, and can be phosphorylated by OsMPK3, OsMPK7, and OsMPK14[5].

Mutation

Overexpression of WRKY30 in rice shows enhanced disease resistance to the bacterial pathogen Xoo(fig.1), sheath blight fungus Rhizoctonia solani(fig.2) as well as M. oryzae[3][4].

Overexpression of OsWRKY30 in rice dramatically increased drought tolerance(fig.3). Mutations in the phosphorylation target sites of OsWRKY30 have been shown to cause the loss of function of drought tolerance. That result suggests that OsWRKY30 phosphorylation is important for its biological functions in defense responses to abiotic stress[5].

Expression

Fig.4 The expression of OsWRKY30 induced by blast infection in the presence of Pi36.
Fig.5 Induced expression of the WRKY30 gene. Plants are treated with salicylic acid (SA) and methyl jasmonate (MeJA).
Fig.6 Expression analysis of OsWRKY30 under stress and hormone treatments. A. Expression level of OsWRKY30 under 100 uM ABA treatment (time course: 0,1, 3, 6, 12, and 24 h). B. Expression level of OsWRKY30 under drought stress (time course: 0, 1, 3, 6,12, and 24 h).
WRKY30 exists as a single copy in the rice genome. The transcript levels of WRKY30 are relatively high in stem, leaf and grain, next are root and panicle, and the least was flower(fig.7)[6].
Fig. 7 Expression patterns of WRKY30 in different rice organs

It is first induced at 1 h p.i. in cv.Kasalath. Its expression level increased up to maximum by 24 h p.i., decreased slightly by 48 h p.i., produced a second peak around 72 h p.i., and finally declined by 96 h p.i.(fig.4)[7].

As shown in Fig. 5, the WRKY30 transcripts began to accumulate at 1 h and strongly increased during 6–12 h after MeJA treatment, followed by a sharp decrease to the background level at 24 h. Also, the expression of WRKY30 increased rapidly but modestly within 1 h, continued to increase at 6 h, and maintained at a steady level till 24 h after SA treatment[4]. The expression of OsWRKY30 is induced after treatments with ABA and drought stress (Fig. 6). The expression of OsWRKY30 gene is investigated using Real-time PCR. OsWRKY30 is significantly increased by treatments with 100 uM ABA, and the expression reached the highest expression (by 13.7 times) at 12 h after treatments (Fig. 6A). A similar OsWRKY30 expression pattern is found after drought stress treatments (Fig. 6B)[5].

Primer Forward primer Reverse primer
3'end amplication 5'-AAAAAGCAGGCTACATGCAGATGATCTCCAAG-3' 5'-AGAAAGCTGGGTGCTCTTGACCATGGAATGGA-3'[8]
5'-AAAAAGCAGGCTTCATGGACGGGACCAACAAC-3' 5'-AGAAAGCTGGGTTCATCTGAGGATGCTGCTTT-3'[8]
RT-PCR 5'-CTACCAATGGTCTTCTTCACC-3' 5'-GTTCACCTTCATCTCACCTCT-3' [2]
5'-TTGGGATTGTCACCTTTTCATG-3' 5'-TTTTACATCTGAGGATGCTGC-3' [4]
5'-GATGATGGTTACCGTTGGCG-3' 5'-CTCAGTTTGGCTATGGCTCA-3' [7]
5'-CAGGCTACCAATGGTCTTCTTCA-3' 5'-GCTACAATAACACTCCATTCTCC-3' [8]

Evolution

It is hypothesized that WRKY genes originated from two eukaryotic species, Giardia lamblia and Dictyostelium discoideum, and have since then been greatly amplified in plant species[2].The WRKY30 containes an entire ORF in length of 2022 bp and encodes a protein of 674 amino acid residues consisting of two WRKY domains each with a zinc finger motif of C2H2 and a nuclear localization signal, belonging to the WRKY subgroup I. WRKY30 shares high amino acid sequence identity with those from monocots such as wheat (Hordeum vulgare), Sorghum bicolor and Brachypodium sylvaticum. The identity are 61.2%,57.0% and 56.0%, respectively(fig8)[6].
Fig. 8 Phylogenetic tree of WRKY30 with WRKY proteins from other species. At, Arabidosis thaliana (AF418308_1); Bs, Brachypodium sylvaticum (CAJ26376); Hv, Hordeum vulgare (ABI13407); Os, Oryza sativa (ADK13079); Pt, Populus trichocarpa (XP_002330532); Rc, Ricinus communis (XP_002529203); Sb, Sorghum bicolor (XP_002444812); Sl, Solanum lycopersicum (CAC36402); Ta, Triticum aestivum (CAJ19358); Vv, Vitis vinifera (XP_002265612); Zm, Zea mays (NP_001169214)

You can also add sub-section(s) at will.

Labs working on this gene

1. Graduate School of Biotechnology & Plant Metabolism Research Center, Kyung Hee University, Yongin 449-701, Korea.

2. Key Biotechnology Laboratory of State Ethnic Affairs Commission, College of Life Science, South-Central University for Nationalities, Wuhan 430074, China.

3. Laboratory of Plant Resistance and Genetics, College of Resources and Environmental Sciences, South China Agricultural University, Guangzhou 510642, China.

4. National Academy of Agricultural Science, Rural Development Administration, Suwon 440-707, Korea.

5. School of Life Sciences, Hunan University of Science and Technology, Taoyuan Rd., Xiangtan 411201, Hunan, China

6. National Engineering Research Center for Molecular Crop Design, Beijing Weiming Kaituo Agriculture Biotech Co., Ltd, Beijing 100085, People’s Republic of China.

References

  1. Eulgem, T., Rushton, P. J., Robatzek, S., & Somssich, I. E. (2000). The WRKY superfamily of plant transcription factors. Trends in plant science, 5(5), 199-206.
  2. 2.0 2.1 2.2 2.3 Ryu, H. S., Han, M., Lee, S. K., Cho, J. I., Ryoo, N., Heu, S., ... & Jeon, J. S. (2006). A comprehensive expression analysis of the WRKY gene superfamily in rice plants during defense response. Plant cell reports, 25(8), 836-847.
  3. 3.0 3.1 Han, M., Ryu, H. S., Kim, C. Y., Park, D. S., Ahn, Y. K., & Jeon, J. S. (2013). OsWRKY30 is a transcription activator that enhances rice resistance to the Xanthomonas oryzae pathovar oryzae. Journal of Plant Biology, 56(4), 258-265.
  4. 4.0 4.1 4.2 4.3 Peng, X., Hu, Y., Tang, X., Zhou, P., Deng, X., Wang, H., & Guo, Z. (2012). Constitutive expression of rice WRKY30 gene increases the endogenous jasmonic acid accumulation, PR gene expression and resistance to fungal pathogens in rice. Planta, 236(5), 1485-1498.
  5. 5.0 5.1 5.2 Shen, H., Liu, C., Zhang, Y., Meng, X., Zhou, X., Chu, C., & Wang, X. (2012). OsWRKY30 is activated by MAP kinases to confer drought tolerance in rice. Plant molecular biology, 80(3), 241-253.
  6. 6.0 6.1 彭喜旭, 胡耀军, 唐新科, 周平兰, 邓小波,&王海华 (2011). 茉莉酸和真菌病原诱导的水稻 WRKY30转录因子基因的分离及表达特征. 中国农业科学 44, 2454-2461.
  7. 7.0 7.1 Liu, X., Li, Y., Wang, L., Liu, X., Wang, C., Wang, L., & Pan, Q. (2010). The effect of the rice blast resistance gene Pi36 on the expression of disease resistance-related genes. Chinese Science Bulletin, 55(18), 1881-1888.
  8. 8.0 8.1 8.2 Lee, H., Ko, Y. J., Cha, J. Y., Park, S. R., Ahn, I., & Hwang, D. J. (2013). The C-terminal region of OsWRKY30 is sufficient to confer enhanced resistance to pathogen and activate the expression of defense-related genes. Plant Biotechnology Reports, 7(3), 221-230.

Structured Information

Gene Name

Os08g0499300

Description

WRKY transcription factor 30

Version

NM_001068683.1 GI:115477103 GeneID:4345940

Length

3901 bp

Definition

Oryza sativa Japonica Group Os08g0499300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 8

Location

Chromosome 8:24733937..24737837

Sequence Coding Region

24734071..24734572,24734775..24734960,24735048..24735790,24735956..24736117,24736388..24736819

Expression

GEO Profiles:Os08g0499300

Genome Context

<gbrowseImage1> name=NC_008401:24733937..24737837 source=RiceChromosome08 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008401:24733937..24737837 source=RiceChromosome08 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacgggaccaacaaccatggagcactgatggacgattggatgcttccctcacccagtccaagaacactcatgtcgagtttcttgaacgaagaattcagctccggtcccttttcagacattttctgtgataatggcagtaacaaacatcaggatggacttgggaagagcaaagctttcatcgattcaagccgggaagaaactgctcagctagcaaaaaagtttgaatcaaacctttttggtgccaaccagaaatcaagctcaaatggctgtctgtcagagaggatggctgcaaggacaggttttggtgtcctgaaaattgatacatctcgtgtcggttattctacaccgattcggtctccggtgacgatcccgcccggtgtgagtccaagggaacttcttgagtcgccggtttttcttccgaacgccattgcacaaccttctcctaccactggcaaactgccatttttgatgcatagtaatgttaaaccatcgatccctaaaaaaactgaagatgaaacacgccatgatcgtgtattcttctttcaacccattttgggatctaagccaccaacttgtccagttgcagagaagggtttcagtgttaatcatcaaaaccagccttcagtgacggataatcaccaggagctcagtcttcagtctagctcaactgcagccaaggatttcacttcagcaactattgttaaacctaagacatctgattccatgttagacaatgatgatcacccttcccctgcaaatgatcaagaagagaatgcaacaaacaaaaatgaagagtattcttcagacctgatcattacccctgctgaggatggatataactggaggaaatatggacagaagcaagttaagaacagtgagcatcccagaagctactacaaatgcactttcacgaattgcgctgtcaagaaggtggagcgttctcaagatggccaaataacagagatagtctacaaaggttctcacaatcaccctttgccgccttccaaccgccgaccaaatgttcctttctcacacttcaatgatctgagagatgatcactctgagaaatttggttccaagtctggtcaggccacagcaacttcatgggagaatgccgcaaatggacacctccaagatgtcggtagtgaagttctgacaaaactgtctgcttctcttacgacaacagaacatgctgaaaaatctgttatggacaaacaagaagctgtggatatctcatcgacgctctccaatgaagaggatgatagggtaacgcatcgtgccccgctttctctgggctttgatgcgaacgatgactatgttgaacacaagagaagaaagatggatgtttatgccgctactagcactagcaccaacgccatcgacataggagctgtggcgtcaagagctatccgggagcctcgcgttgttgttcagaccacaagtgaggttgacatccttgatgatggttaccgttggcgcaagtatgggcagaaagttgtcaaaggaaacccaaatccaaggagctactacaagtgcactcatccgggttgctcggtgcgcaagcatgtggagcgatcatcgcatgatctgaaatccgtcatcacgacgtatgaaggaaagcacaaccatgaagttccagctgccaggaacagtggccacccaagctcaggctcagccgctgcaccacaggctaccaatggtcttcttcaccggagacctgaaccggcacaaggtggtggtggtggtagccttgctcagtttggctatggctcagctggtcacagaccagcagagcagtttggtgcagcagcagctggtttctcctttggaatgctgcctcgtagcattgcaactccggcgccgtctccggcgatcgccgtgccggcgatgcaggggtacccagggcttgtgctgccgagaggtgagatgaaggtgaacttgctgccacagtctgggaatgctggtgcagcagctagccagcagctgatgggcaggttgccaaagcagcatcctcagatgtaa</cdnaseq>

Protein Sequence

<aaseq>MDGTNNHGALMDDWMLPSPSPRTLMSSFLNEEFSSGPFSDIFCD NGSNKHQDGLGKSKAFIDSSREETAQLAKKFESNLFGANQKSSSNGCLSERMAARTGF GVLKIDTSRVGYSTPIRSPVTIPPGVSPRELLESPVFLPNAIAQPSPTTGKLPFLMHS NVKPSIPKKTEDETRHDRVFFFQPILGSKPPTCPVAEKGFSVNHQNQPSVTDNHQELS LQSSSTAAKDFTSATIVKPKTSDSMLDNDDHPSPANDQEENATNKNEEYSSDLIITPA EDGYNWRKYGQKQVKNSEHPRSYYKCTFTNCAVKKVERSQDGQITEIVYKGSHNHPLP PSNRRPNVPFSHFNDLRDDHSEKFGSKSGQATATSWENAANGHLQDVGSEVLTKLSAS LTTTEHAEKSVMDKQEAVDISSTLSNEEDDRVTHRAPLSLGFDANDDYVEHKRRKMDV YAATSTSTNAIDIGAVASRAIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKGNPNPR SYYKCTHPGCSVRKHVERSSHDLKSVITTYEGKHNHEVPAARNSGHPSSGSAAAPQAT NGLLHRRPEPAQGGGGGSLAQFGYGSAGHRPAEQFGAAAAGFSFGMLPRSIATPAPSP AIAVPAMQGYPGLVLPRGEMKVNLLPQSGNAGAAASQQLMGRLPKQHPQM</aaseq>

Gene Sequence

<dnaseqindica>3266..3767#2878..3063#2048..2790#1721..1882#1019..1450#tccttcgcttcaccacctcgccaaaaccgccttcccttcccttctcttcccttccaacctctcgttgcggtttgcgctagaaaaaaaagagaggagagatttcaagaaaccgtgggggagaaagaagcaggcaagaagtagcagcagcagcgagtgaggctaatctggtcagtttcagaacagattctttgttcggtctctatccattgcaagaacaggttttgttttttcttttccctttttttgggatcagagtctctccatttctgatgctgctgctgctgctgatgatgatgatgatgcaaggcttgtggcaacttgtttggtgaaagaacaacgagagggatactgggatagggatcaaaggcaaaggtttttgtttttaccccgtggtaattgttcgttcggtttgtgatgggatagttgctgggactgtgaatcattttgccccttcttatcatacagacaggcgcgtgatttgaccagcttgtcgtctctgctctgcctctatccatccatccattcatacatccaaccttgggggttcttgattctttttctcatttcttggggaggcttaattgttgctatcgccctccgcttcaggtgtccatttgaattcttcgtcgtttctttcgtatttaattgccatttgctgatttgcctctttatttcggtgggttttatggtaataaaggtgtggttcctttatcatcaaatttgaggtgttctgggttttctttggttcttttttggagcactggatttgtgtgctcttgtaaatcaaatagagtttgtggtttggttcgtattttacacaatcgagttgtgtttttattttagtttgtatcgaaatatttgcatacttgtttctagttccttcaggcttcagttctcttcattattataaaaaaaaatttggtcctttcgtccataatttttttcacaattccatttttgaatgtatgagcttgaattatgtgacttttcagtttgagcttgggattgtcaccttttcatggacgggaccaacaaccatggagcactgatggacgattggatgcttccctcacccagtccaagaacactcatgtcgagtttcttgaacgaagaattcagctccggtcccttttcagacattttctgtgataatggcagtaacaaacatcaggatggacttgggaagagcaaagctttcatcgattcaagccgggaagaaactgctcagctagcaaaaaagtttgaatcaaacctttttggtgccaaccagaaatcaagctcaaatggctgtctgtcagagaggatggctgcaaggacaggttttggtgtcctgaaaattgatacatctcgtgtcggttattctacaccgattcggtctccggtgacgatcccgcccggtgtgagtccaagggaacttcttgagtcgccggtttttcttccgaacgccattgtaagtgacttcctcacctcaatcagtatttgctctgtgtaatgttcagttactctactcatgtggtttatatggaggatatatttgtcagtaaatggtgaaatctaaaccaagatacctattataaaaaatattctaacgcaagatacagcatctttaatttctcttatgtctctgcagcttcgtataattagtggaattttggagaagaaagtgactatatatgttgatgactgattaatcttaatgtcatggttttgatttatgcaggcacaaccttctcctaccactggcaaactgccatttttgatgcatagtaatgttaaaccatcgatccctaaaaaaactgaagatgaaacacgccatgatcgtgtattcttctttcaacccattttgggatctaagccaccaacttgtccagttgcagagaaggtagttttctcaaacaatgttgttctattccctatttactgcaaatctgtaatcactgctcgcctgctcggcgcagtttgttttactgttccagcaaatctgacgagcaaaatcaaattatcagtgttttttatgcattggtctgatgatatttatacttttcagggtttcagtgttaatcatcaaaaccagccttcagtgacggataatcaccaggagctcagtcttcagtctagctcaactgcagccaaggatttcacttcagcaactattgttaaacctaagacatctgattccatgttagacaatgatgatcacccttcccctgcaaatgatcaagaagagaatgcaacaaacaaaaatgaagagtattcttcagacctgatcattacccctgctgaggatggatataactggaggaaatatggacagaagcaagttaagaacagtgagcatcccagaagctactacaaatgcactttcacgaattgcgctgtcaagaaggtggagcgttctcaagatggccaaataacagagatagtctacaaaggttctcacaatcaccctttgccgccttccaaccgccgaccaaatgttcctttctcacacttcaatgatctgagagatgatcactctgagaaatttggttccaagtctggtcaggccacagcaacttcatgggagaatgccgcaaatggacacctccaagatgtcggtagtgaagttctgacaaaactgtctgcttctcttacgacaacagaacatgctgaaaaatctgttatggacaaacaagaagctgtggatatctcatcgacgctctccaatgaagaggatgatagggtaacgcatcgtgccccgctttctctgggctttgatgcgaacgatgactatgttgaacacaagagaaggttggctagccttagtcactaatcactcaatgaaccaatcttcactttgagtagctgattgttttccttcaattttattcatttcagaaagatggatgtttatgccgctactagcactagcaccaacgccatcgacataggagctgtggcgtcaagagctatccgggagcctcgcgttgttgttcagaccacaagtgaggttgacatccttgatgatggttaccgttggcgcaagtatgggcagaaagttgtcaaaggaaacccaaatccaaggtcaattctaatgccatttttctcttttggaacaaattctttgcagttcctctaatccttcactacaaaagtaaatgtttagcttcacaatatgacactgtcatcgaaggaacatttctctgtccatatgtgtgcatccatagttggtacaaagaccggaaattactcgcattatctaaaaaactccattttgtatttgcaggagctactacaagtgcactcatccgggttgctcggtgcgcaagcatgtggagcgatcatcgcatgatctgaaatccgtcatcacgacgtatgaaggaaagcacaaccatgaagttccagctgccaggaacagtggccacccaagctcaggctcagccgctgcaccacaggctaccaatggtcttcttcaccggagacctgaaccggcacaaggtggtggtggtggtagccttgctcagtttggctatggctcagctggtcacagaccagcagagcagtttggtgcagcagcagctggtttctcctttggaatgctgcctcgtagcattgcaactccggcgccgtctccggcgatcgccgtgccggcgatgcaggggtacccagggcttgtgctgccgagaggtgagatgaaggtgaacttgctgccacagtctgggaatgctggtgcagcagctagccagcagctgatgggcaggttgccaaagcagcatcctcagatgtaaaaatggcaggaacatgagacaaatggtgtttgctgcttatgtatatgaaacatttttggtgcttttgttaggagaatggagtgttattgtagctcaatttactttcgggggaaaaaaaagcagatagttcaggc</dnaseqindica>

External Link(s)

NCBI Gene:Os08g0499300, RefSeq:Os08g0499300