Os07g0155600

From RiceWiki
Revision as of 05:20, 31 May 2014 by Xiaomaixu (talk | contribs) (Genes in other plants)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

1. MHZ7/OsEIN2 encodes a membrane protein homologous to EIN2, a central component of ethylene signaling in Arabidopsis. OsEIN2 is a positive component of the ethylene-signaling pathway in rice.

2.By screening the cDNA library, Rice OsEIN2 gene was isolated, The OsEIN2 cDNA is 4,646 bp long and carries an ORF that putatively encodes a polypeptide of 1. 2. 281 amino acids with a predicted molecular mass of 138 kDa, OsEIN2 in the COOH-terminal domain were particularly highly conserved .The C-terminal end of the glucose sensor was also known to function as a signal transmitter by interacting with downstream components for ethylene signal transduction for the presence of a coiled–coil motif in the EIN2 C-terminal.

3. OsEIN2 in rice and AtEIN2 in Arabidopsis thaliana , the amino acid sequence is of a significant similarity, the similarity is about 57%, and 42% is the same sequence, the position of exons and introns in these two plants are conservative.

4. MHZ7 regulates distinct ethylene-response phenotype in rice.. mutant MHZ7 ,it insensitive to ethylene in both root and coleoptile.

Expression

1. From the result of the GUS stainning, it indicates that MHZ7 is expressed in various organs and may play major roles in root, coleoptile and grain development. MHZ7 gene is aboundantly expressed in coleoptiles and roots compared to other organs. It is also expressed in shoot tips and in mature leaf and stem, but it is not detected in root tips. The GUS staining is mainly concentrated on top of the seed coat, the second layer from the outside fruit coat pericarp.

2. Antisense expression of OsEIN2 in transgenic rice seedlings leads to inhibition of shoot elongation. Yield-related traits including grain size, 1000-grain weight, and leaf senescence are also affected by MHZ7 expression.

3. MHZ7 overexpression leads to constitutive ethylene response and confers enhanced response to ethylene treatment. MHZ7-overexpressing plants is shorter and more erect than WT plant. The grain of MHZ7-overexpressing plants is increased, but the width is not significantly changed.

4. The expression of OsEIN2 is not affected by exogenous ACC or AgNO3

Evolution

Please input evolution information here.

Genes in other plants

1. EIN2-like protein (DCEIN2), The cDNA contained an open reading frame of 3828 bp corresponding to 1275 amino acids. The northern blot results indicated that DCEIN2 expression in both the petals and ovaries was enhanced by treatment with exogenous ethylene and sugar, respectively, and was inhibited by silver thiosulfate.

2. LjEIN2-1 and LjEIN2-2, from L. japonicus. These genes share moderate similarity in their amino acid sequences, are located on different chromosomes and are composed of different numbers of exons。Simultaneous suppression of both LjEIN2-1 and LjEIN2-2 markedly increased the ethylene insensitivity of transgenic roots and resulted in an increased nodulation phenotype.

3. In Melon, the ethylene insensitive 2 (EIN2) is an integral membrane protein in the endoplasmic reticulum, it is an important regulator of ethylene and other phytohormone signaling. The cDNA contained an open reading frame of 3876 bp corresponding to a polypeptide of 1291 amino acids with a predicted mol wt of 141 kD. CmEIN2 mediates ethylene signals in many processes and is a component of signal transduction by ethylene, auxin, and abscisic acid.

Labs working on this gene

1. State key lab of Plant Genomics, Institute of Genetic and Development Biology, Chinese Academic of Science, Beijing 100101, China 2. Biotechnology Reseach Institute/National Key Facility for Genetic Resource and Gene Improvement, Chinese Academy of Agricultural Science, Beijing 10081, China 3. National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Pohang University of Science and Technology (POSTECH), Pohang, 790-784 Korea 4. Department of Biology, College of Science, Yonsei University, Seoul, 120-749 Korea

References

[1] Biao Ma, Si-Jie He, Shou-Yi Chen, Jin-Song Zhang. Identification of rice ethylene-response mutants and characterization of MHZ7/OsEIN2 in distinct ethylene response and yield trait regulation. Molecular Plant 6,1830-1848(2013).

[2]Sung-Hoon Jun , Min-Jung Han, Woo Taek Kim and Gynheung An. OsEIN2 is a Positive Component in Ethylene Signaling in Rice. Plant Cell Physiol. 45(3): 281–289 (2004).

[3]F. Gao,J. Hao, X. Wang, A. Hasi. Cloning and characterization of ethylene-insensitive 2(EIN2)gene from Cucumis melo. Russian Jounal of Plant Physiology. 60(5): 713-719 (2013).

[4] Zhaodi Fu, Huinan Wang, Juan Liu, Jing Wang. Cloning and characterization of a DCEIN2 gene responsive to ethylene and sucrose in cut flower carnation. Plant Cell. 105(3): 447-455(2011).

[5] Kana Miyata, Masayoshi Kawaguchi, Tomomi Nakagawa. Two Distinct EIN2 gene cooperatively regulate ethylene signaling in Lotus japonicus. Plant and Cell Physiology. 54(9): 1469-1477(2013).

Structured Information

Gene Name

Os07g0155600

Description

EIN2

Version

NM_001065455.1 GI:115470642 GeneID:4342431

Length

6484 bp

Definition

Oryza sativa Japonica Group Os07g0155600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:3016580..3023063

Sequence Coding Region

3016900..3017175,3017718..3017804,3017926..3018039,3018138..3018350,3019216..3019392
,3019511..3022168,3022311..3022631

Expression

GEO Profiles:Os07g0155600

Genome Context

<gbrowseImage1> name=NC_008400:3016580..3023063 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:3016580..3023063 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggatgggcagcagctacgtagctcggaatctccggcgagcggcggcggcggagtcaccggcggcggcgcgccacatctgttccacgcgctcgggccggcgctgctgatctcgattgggtacattgacctcgggaaatgggtggccgcggtggaggcagggtcacggttcggccttgacctcgtgctgctggccctcctcttcaacttcatggccatcctgtgccagtatctcgcggcttgcattggcacggtcaccgggaggagcctcgccgagatctgccaccaagaatacagcaggccaacatgcatctttctgggtgttcaagcaggattgtccttgttgacatcagaattgacgatgatttttgggatagcacttggattcaatcttctatttgaatatgatgatctcatcactgggatatgttttgcaaccgttgttcctaatctgctaccatatgctatatcacacctgggaaagaagatggtggggacattaaatgcttgcattgcaggctttgcgcttctttgctacgttcttggtttattggtcagccaaccacaaattcctctgacaacgaatgtaattttccccaagctcagtggtgaaagtgcttattctctgatggctcttcttggtgcaaacgtaatggcacacaacttttacatccattcatcagttgttcagggtcagaaaagatctgcctttgctgttggtgccttatttcatgatcacttgttttcagtattatttatttttactggaatttttctggtgaatcatgttctaatgaactctgcagcagctgattccactaacacccttcttctcaccttccaagatgttgtagaactaatgaaccagatatttgtaaaccctatggctccaactatatttctagtggttcttctcttctctagccacatcatctcgttgacatctgctattggtagccaagtgatttcgcagcatttgtttggcattaatcttcctctctctggacatcatctgatactgaaggcttttgccatagttcctgctctgtactgtgctaaggttgcaggtgctgaaggaatataccaattactgataatctgccagattatccaggccatgctccttccatcatcagtcgtgccactcttccgtgttgcctcatcaagattgataatgggtgcccacagagtgtctttgcatctggagatattaacatttcttgcatttctcctcatgctgttttcgaatatcatctttatggcagaaatgctgtttggtgacagtggttggctgaacactctgaaagggaatactggaagccctgtggtgtttccatctacggttctcatcacggtggcttgtgtctctgttgcattttcactctacatggctgttacaccactgaaatcaggaagccatgaagctgaattgcagcaggaatggtctgtgccttctcagaaagagctcttgaatactactcaagacagagaagagacttgtgcgggcaatgttacctatgaggaagatcagagatctgatgttgtcccttctcctaggattcagcctgtggattgtctgaaatcagctctggactacattgatagttcggacacagctatagaatctgatcatgattctcaacattccactgctcatacatctaccgctcctgaatcctgtcactctccatcattcattcctgaagagtcaaaatcagttgttgctgttgactggccagagcctctggagccaatttctaatgctattgtggctgaggaaagtacagtagagagtgtggactccaagagcacaggcgaaagggatattgaagtagaaccagctcttttgatggacaatgataaggaggctccaaatattctagagtctgacaacaagccacttggaggcaataatccttcctgtgcatcggatgatggcccaccatctcttaccttcagcagggggaaaggctcagatgcaggcaatggcagcgggagtctctcgaggttatctggtttgggccgtgcagcaaggaggcaactagcagccatacttgatgagttctgggggcatctctttgattaccatgggaaactcactcaagaagctagctctaaaaggtttgacatcttgcttgggctagacgtaagaacacctagctcaactgtaagagcagacagtcaagctaatgaaatcccgaagagtcccatggtacgagacaatttacaagggtctgccttcttgggaagttcaagggatctgatgtctactaagaatgagatgtcgaatttggatctgacatatgggcttcagatgggcaataacattgggtcatcagcctggtctcagggcatgcagttaccaagtacccaactgcagagttcaagcaacagcttactcgatcaaggtgcaagattaaattcaaattttagcacgccatcatacgcagacaacaaccaattctaccaacctgcaacgattcatgggtatcagctcgcatcatacctaaaacagatgaatgctaatcgaaatccttactctagcatgccattggacccacagcgacttccaaaatcttctgcatcggctgtgccaacctatgtcgattctgtcatgcatgctcgtaaccagaacttgcttgcttcattgggagctactccttcacagatcgcagcaacatcccggataggtactatgatggcagaaagatcctattatgtcccttccactcttgacgggaatgaaaatgctggttcatcagcttactcaaagaagtaccacagctcaccagacatatctgcactgattgctgcaagcaggagtgctctgttgaatgaatcaaagttgggtggtggtaccattggatcccagtcgtaccttagcaggcttgcatcggaaagatctcagtatacaaactcggtggccaggcctgcagctcccttggcgtttgatgagctctctccacctaagctcccaggggatatcttctcaatgcaacaaagcccaaacccaagtgcaagatccctttgggctaagcaaccttttgagcagctgtttggtgtgtcgagtgcggagctcactaaaagcgagttcaaccctgcaggcagatcgggtggcatgaccaaggatgatttctcttacaaggagtctgaggcgaagcttcttcagtctcttagattctgcatctcgaagctcctgaagctagaaggatcagggtggctgttcaagcaaaatggtggcagcgacgaagatctgattgatcaagttgctgcggtagagaagctattgcaacaaggaaccagtgacaaccaactgctgcttggtgatactcagcaaccaccatgtgataaggcagacatccagtacatgcgcgtactgcctaactgcggagacgactgcatctggcgcgcctccctcgttgtcagcttcggtgtctggtgcatccgccgggtgctagacctgtctctggtggaaagcaggccagaactttggggcaagtatacctatgttctcaaccgtcttcagggcatcctggatcctgcattctccaagcctcggagtgctctcagcgcgtgtgcgtgccttcacagagatatccgggtgctcaacagcctgcgccacagtagcctggtagcaacaaactccattccaaggcaaatccgaggttccttcaccaccgcatctgtggtcctggagatgatcaaggatgtggagaccgcagtctcagggcgcaagggcaggagtggcaccgcagctggggatgtcgccttccccaaggggaaggagaacctggcctccgtgctgaagcgatacaagcggaggctctcgagcaagggacaacaataa</cdnaseq>

Protein Sequence

<aaseq>MDGQQLRSSESPASGGGGVTGGGAPHLFHALGPALLISIGYIDL GKWVAAVEAGSRFGLDLVLLALLFNFMAILCQYLAACIGTVTGRSLAEICHQEYSRPT CIFLGVQAGLSLLTSELTMIFGIALGFNLLFEYDDLITGICFATVVPNLLPYAISHLG KKMVGTLNACIAGFALLCYVLGLLVSQPQIPLTTNVIFPKLSGESAYSLMALLGANVM AHNFYIHSSVVQGQKRSAFAVGALFHDHLFSVLFIFTGIFLVNHVLMNSAAADSTNTL LLTFQDVVELMNQIFVNPMAPTIFLVVLLFSSHIISLTSAIGSQVISQHLFGINLPLS GHHLILKAFAIVPALYCAKVAGAEGIYQLLIICQIIQAMLLPSSVVPLFRVASSRLIM GAHRVSLHLEILTFLAFLLMLFSNIIFMAEMLFGDSGWLNTLKGNTGSPVVFPSTVLI TVACVSVAFSLYMAVTPLKSGSHEAELQQEWSVPSQKELLNTTQDREETCAGNVTYEE DQRSDVVPSPRIQPVDCLKSALDYIDSSDTAIESDHDSQHSTAHTSTAPESCHSPSFI PEESKSVVAVDWPEPLEPISNAIVAEESTVESVDSKSTGERDIEVEPALLMDNDKEAP NILESDNKPLGGNNPSCASDDGPPSLTFSRGKGSDAGNGSGSLSRLSGLGRAARRQLA AILDEFWGHLFDYHGKLTQEASSKRFDILLGLDVRTPSSTVRADSQANEIPKSPMVRD NLQGSAFLGSSRDLMSTKNEMSNLDLTYGLQMGNNIGSSAWSQGMQLPSTQLQSSSNS LLDQGARLNSNFSTPSYADNNQFYQPATIHGYQLASYLKQMNANRNPYSSMPLDPQRL PKSSASAVPTYVDSVMHARNQNLLASLGATPSQIAATSRIGTMMAERSYYVPSTLDGN ENAGSSAYSKKYHSSPDISALIAASRSALLNESKLGGGTIGSQSYLSRLASERSQYTN SVARPAAPLAFDELSPPKLPGDIFSMQQSPNPSARSLWAKQPFEQLFGVSSAELTKSE FNPAGRSGGMTKDDFSYKESEAKLLQSLRFCISKLLKLEGSGWLFKQNGGSDEDLIDQ VAAVEKLLQQGTSDNQLLLGDTQQPPCDKADIQYMRVLPNCGDDCIWRASLVVSFGVW CIRRVLDLSLVESRPELWGKYTYVLNRLQGILDPAFSKPRSALSACACLHRDIRVLNS LRHSSLVATNSIPRQIRGSFTTASVVLEMIKDVETAVSGRKGRSGTAAGDVAFPKGKE NLASVLKRYKRRLSSKGQQ</aaseq>

Gene Sequence

<dnaseqindica>321..596#1139..1225#1347..1460#1559..1771#2637..2813#2932..5589#5732..6052#atccatctcgagttcgattggggttttttttttctctcttgaggttgctggtgatgagcttcactttcttggattgattttttttttgttcttgttcgttgagtttttcactttgctctaatccaaatcttttttttctctctctctctctctaatatccataattaatctgcagatttccatgattggtggtggagttcatcggcaaggaattcagcagaagagatcagattctgtacacagttcgtcttcttgctcggtgactaagctgggttaggagaggaggaaaagaaaatctttttttttttttttgcggcgccatggatgggcagcagctacgtagctcggaatctccggcgagcggcggcggcggagtcaccggcggcggcgcgccacatctgttccacgcgctcgggccggcgctgctgatctcgattgggtacattgacctcgggaaatgggtggccgcggtggaggcagggtcacggttcggccttgacctcgtgctgctggccctcctcttcaacttcatggccatcctgtgccagtatctcgcggcttgcattggcacggtcaccgggaggagcctcgccgaggtatttcgagatgcttctcacctgatgtttttgttttgtctgattttgtagtggtgaatgattcatcatcatcctcatcatcgtcagtcaattgatcgacatcggtttgtcgtttcgcaaatggtagaaatgatgatgggtttttgatactgaattgagcctctgagcgaattctgatgagtaggaaaagcatcttcataatgaaggtcctaaatctcgtatgtgaattcctgttgataaagaaaatgatggttcacttggaactatacttgtgcaaaagaatcctattcttttttttttggtgcccttatggtgtatatgttgtgatagtaaacaaagaaaggaggtgttttgttttcggaaatggtggaaaaggaacttttgctcatctcaagttccctttctagctggccattttgcggagggggaaaaaccaactttccctgtaaaacagtgtgctttgatccttctatgttattcgttttgttcgtgaaattctttcgaggttgctgacatttttgtgttttccacatggaacaaagatctgccaccaagaatacagcaggccaacatgcatctttctgggtgttcaagcaggattgtccttgttgacatcagaattgacgatggtattttcagcctcttctcttttcgatatttaatatgagatctgagcctgagaaatttcagccataaatgctgcatgttttgcacatgctttgttctgattgtaatatctggcaatttcagatttttgggatagcacttggattcaatcttctatttgaatatgatgatctcatcactgggatatgttttgcaaccgttgttcctaatctgctaccatatgctatatcacacctggtaaagaagaagattatctcatatagaaaacttcaaacctatattgtaatctgatttggagttaatatttgtcaattactttcatatacctattctagggaaagaagatggtggggacattaaatgcttgcattgcaggctttgcgcttctttgctacgttcttggtttattggtcagccaaccacaaattcctctgacaacgaatgtaattttccccaagctcagtggtgaaagtgcttattctctgatggctcttcttggtgcaaacgtaatggcacacaacttttacatccattcatcagttgttcaggtaaattatgatgcttctttgtgcccattacatagttagaattatatttgatttgatgcatttggggtgaggggggtttgggcatttggtggacaatggtcaatggcatgccacaattatttacaccacacaatgacacatgttgctagctttgctagtgtttcgaacagttcagaaattccaaactgatagcaagggtcactatattagactagttataccagtctaatatcggatgtagtggagaatgtttttgttctaatagatccagtggtttgtgggtacgctgtatccaactgaaaaagatatggtttgtcctatttcaattgtttgcgcagagttgaagtgatgttcattgacttaatttcaaaacaccaagatacatcttctagcgaattgcagcattatgttaggcatgctcatcgttagttagtgaaagaatttgttctcacttaatccagtttggagcttaactaacaattatggccaatgaaactatagtatttaataagctattgtgccacatgcggaatactatttctgattgacaagcacaaatctagaatgttccttgagtaaatgtttgttccctaaaactgtggcctatttctatttgttttcttttttactttcgcgtgtacatattttggttcactaatggtaagtgtctagtgttcatgaggtctttgccttaggtttgctagtatatgatatatatattacctaaagtgtataaaaatggatagcattagtgagtttgacagcaaaaccagctacatttcattgccctttgtgtcttatgcttttggttgtctttttttttcagcttgtatccatgtttgctaatcaaataatctcttttcagggtcagaaaagatctgcctttgctgttggtgccttatttcatgatcacttgttttcagtattatttatttttactggaatttttctggtgaatcatgttctaatgaactctgcagcagctgattccactaacacccttcttctcaccttccaagatgttgtagaactaatgaaccaggttagtactatagttcctactacttcaccctgtgatatgctaagctggtgctgaagaaatcttgtttcagtagcaatcctaaagtgatatacactacctaacatttatcattttgcagatatttgtaaaccctatggctccaactatatttctagtggttcttctcttctctagccacatcatctcgttgacatctgctattggtagccaagtgatttcgcagcatttgtttggcattaatcttcctctctctggacatcatctgatactgaaggcttttgccatagttcctgctctgtactgtgctaaggttgcaggtgctgaaggaatataccaattactgataatctgccagattatccaggccatgctccttccatcatcagtcgtgccactcttccgtgttgcctcatcaagattgataatgggtgcccacagagtgtctttgcatctggagatattaacatttcttgcatttctcctcatgctgttttcgaatatcatctttatggcagaaatgctgtttggtgacagtggttggctgaacactctgaaagggaatactggaagccctgtggtgtttccatctacggttctcatcacggtggcttgtgtctctgttgcattttcactctacatggctgttacaccactgaaatcaggaagccatgaagctgaattgcagcaggaatggtctgtgccttctcagaaagagctcttgaatactactcaagacagagaagagacttgtgcgggcaatgttacctatgaggaagatcagagatctgatgttgtcccttctcctaggattcagcctgtggattgtctgaaatcagctctggactacattgatagttcggacacagctatagaatctgatcatgattctcaacattccactgctcatacatctaccgctcctgaatcctgtcactctccatcattcattcctgaagagtcaaaatcagttgttgctgttgactggccagagcctctggagccaatttctaatgctattgtggctgaggaaagtacagtagagagtgtggactccaagagcacaggcgaaagggatattgaagtagaaccagctcttttgatggacaatgataaggaggctccaaatattctagagtctgacaacaagccacttggaggcaataatccttcctgtgcatcggatgatggcccaccatctcttaccttcagcagggggaaaggctcagatgcaggcaatggcagcgggagtctctcgaggttatctggtttgggccgtgcagcaaggaggcaactagcagccatacttgatgagttctgggggcatctctttgattaccatgggaaactcactcaagaagctagctctaaaaggtttgacatcttgcttgggctagacgtaagaacacctagctcaactgtaagagcagacagtcaagctaatgaaatcccgaagagtcccatggtacgagacaatttacaagggtctgccttcttgggaagttcaagggatctgatgtctactaagaatgagatgtcgaatttggatctgacatatgggcttcagatgggcaataacattgggtcatcagcctggtctcagggcatgcagttaccaagtacccaactgcagagttcaagcaacagcttactcgatcaaggtgcaagattaaattcaaattttagcacgccatcatacgcagacaacaaccaattctaccaacctgcaacgattcatgggtatcagctcgcatcatacctaaaacagatgaatgctaatcgaaatccttactctagcatgccattggacccacagcgacttccaaaatcttctgcatcggctgtgccaacctatgtcgattctgtcatgcatgctcgtaaccagaacttgcttgcttcattgggagctactccttcacagatcgcagcaacatcccggataggtactatgatggcagaaagatcctattatgtcccttccactcttgacgggaatgaaaatgctggttcatcagcttactcaaagaagtaccacagctcaccagacatatctgcactgattgctgcaagcaggagtgctctgttgaatgaatcaaagttgggtggtggtaccattggatcccagtcgtaccttagcaggcttgcatcggaaagatctcagtatacaaactcggtggccaggcctgcagctcccttggcgtttgatgagctctctccacctaagctcccaggggatatcttctcaatgcaacaaagcccaaacccaagtgcaagatccctttgggctaagcaaccttttgagcagctgtttggtgtgtcgagtgcggagctcactaaaagcgagttcaaccctgcaggcagatcgggtggcatgaccaaggatgatttctcttacaaggagtctgaggcgaagcttcttcagtctcttagattctgcatctcgaagctcctgaagctagaaggatcagggtggctgttcaagcaaaatggtggcagcgacgaagatctgattgatcaagttgctgcggtagagaagctattgcaacaaggaaccagtgacaaccaactgctgcttggtgatactcagcaaccaccatgtgataaggcagacatccagtacatgcgcgtactgcctaactgcggagacgactgcatctggcgcgcctccctcgttgtcagcttcggtgtctggtgcatccgccgggtgctagacctgtctctggtggaaagcaggccagaactttggggcaagtatacctatgttctcaaccgtcttcaggtgagctatttcagtcctgaactagtctgaatttgagtgttgtttttcagtgcccaagacttgactgcaaacctgaaactgctcattttcaacgtacaagactaactctgtcaatcatttttttcgctcaaatgtaatgcagggcatcctggatcctgcattctccaagcctcggagtgctctcagcgcgtgtgcgtgccttcacagagatatccgggtgctcaacagcctgcgccacagtagcctggtagcaacaaactccattccaaggcaaatccgaggttccttcaccaccgcatctgtggtcctggagatgatcaaggatgtggagaccgcagtctcagggcgcaagggcaggagtggcaccgcagctggggatgtcgccttccccaaggggaaggagaacctggcctccgtgctgaagcgatacaagcggaggctctcgagcaagggacaacaataataaggcatctgggcagcgtgatcctgtcgcgttttagggggactttgaccattgttcttcaaggatggcagccagccatggtggcttgccctccctgagccctggattttttcgttgcacaacgtttgcagggacctgaggaattggccaacacttctggtcccttccatcatatttcgtttttttttgtttctttcttgtttttttttttttttttgcatgtgatgtgttgtataatggtaactgttcatgtgccagaagaacaaccaccaaaatgtacaacagatgtagtcagctgatgcaccattgtaaagtttagtctctgcattttaaccttttttttgggggtcattgacaaactgaatgaatgccctgtgtaatctctcttcagagaggatgccaagactgagaaaaagcttttgccagatttcc</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0155600, RefSeq:Os07g0155600

  1. Biao Ma, Si-Jie He, Shou-Yi Chen, Jin-Song Zhang. Identification of rice ethylene-response mutants and characterization of MHZ7/OsEIN2 in distinct ethylene response and yield trait regulation. Molecular Plant 6,1830-1848(2013).
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. Cite error: Invalid <ref> tag; no text was provided for refs named ref5