Os10g0567400

From RiceWiki
Revision as of 06:48, 1 June 2014 by Mr corn (talk | contribs) (Expression)
Jump to: navigation, search

This gene locus named after OsCAO1 of Oryza sativa Japonica Group, whose length is 2983 bps and 541 amino acids ,plays a major role in chlorophyll b biosynthesis[1]

Annotated Information

Function

knockout mutant lines tagged by T-DNA or Tos17. Mutant plants containing a T-DNA insertion in the first intron of the OsCAO1 gene have pale green leaves, indicating chlorophyll b deficiency.These results suggest that OsCAO1 plays a major role in chlorophyll b biosynthesis

Expression

OsCAO1 is induced by light and is preferentially expressed in photosynthetic tissues.OsCAO1 was expressed strongly in shoots and leaves.


The expression pattern of OsCAO1 was light-dependent

During the reproductive development stages, its expression level was higher in mature than in immature panicles. PCR was performed with cDNA prepared from various vegetative and reproductive organs: 1, calli; 2 and 3, shoots and roots of 7-day-old seedlings; 4, 5, and 6, leaves, stems and roots from 30-day-old plants; 7, fully expanded mature leaves at the flowering stage; 8, panicles <5 cm long; 9, panicles between 10 and 20 cm; 10, panicles between 20 and 30 cm; 11, immature seeds 2 to 5 d after pollination. Rice actin1 OsAct1 transcript was amplified as control.

When seedlings were grown under continuous light, they accumulated higher levels of OsCAO1 transcript than were measured in darkgrown plants. Expression levels of OsCAO1 and OsCAO2 in seedlings 4, 5, and 6 d after germination; DAG grown under continuous light L or darkness D.

When transferred dark-grown seedlings to light conditions,Within the first half hour after transfer, OsCAO1 transcript levels started to increase rapidly, reaching a maximum level in 2 h; when light-grown plants were transferred to dark conditions, OsCAO1 transcript levels decreased. (A) Expression levels after etiolated 4 DAG seedlings were exposed to illumination.(B) Expression patterns of 4 DAG light-grown seedlings after transfer to dark conditions.


Transcript levels of OsCAO1 followed a circadian rhythm

Because the expression pattern of OsCAO1 was light-dependent, we examined whether its transcript level followed a circadian rhythm.Transcript levels of OsCAO1 were higher during the daytime, but much lower in the late afternoon and at night.During the nighttime,OsCAO1 transcript levels were high.the change in expression for OsCAO1 was gradual, reaching a maximum level at 2 PM; its accumulation began in the dark.

Plants were grown in greenhouse 14 h/10 h light/dark, and then transferred to continuous darkness. Flag leaves of two or three plants were harvested for RNA extraction.

OsCAO1 was inducible by all light treatments, but most significantly under blue light.

Expression levels were determined in 4-day-old dark-grown wild-type seedlings after exposure to various light sources. D, darkness; Fr, far-red light; R, red light; B, blue light; W, white light.


Primer Forward primer Reverse primer
RT-PCR 5'-tcaaccattggcatctcaaa-3' 5'-cgtgatgctgtcgctagtgt-3'
DNA pool screening 5'-tacagatcatgggattcaaaattggac-3' 5'-ttacccactgctcctcaaaacaatcta-3'

Evolution

This class of proteins (chlorophyll a oxygenase (CAO) protein) they encode contain two conserved functional motifs – the Rieske Fe–sulfur coordinating center and a non-heme mononuclear Fe-binding site.

Phylogeneic trees of the proteins containing the conserved Rieske [2Fe–2S] binding site from rice and Arabidopsis

You can also add sub-section(s) at will.

Labs working on this gene

  • National Research Laboratory of Plant Functional Genomics, Division of Molecular and Life Sciences, Pohang University of Science and Technology (POSTECH), Pohang 790-784, Korea
  • Department of Molecular Biology, Pusan National University, Keumjung-ku, Pusan 609-735, Korea
  • Department of Molecular Genetics, National Institute of Agrobiological Sciences, Kannondai 2-1-2, Tsukuba, Ibaraki 305-8602, Japan

References

[1] Sichul Lee,et.al,Differential regulation of chlorophyll a oxygenase genes in rice,Plant Molecular Biology (2005),57:805–818

Structured Information

Gene Name

Os10g0567400

Description

Rieske [2Fe-2S] region domain containing protein

Version

NM_001071965.1 GI:115483525 GeneID:4349433

Length

3509 bp

Definition

Oryza sativa Japonica Group Os10g0567400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:22938211..22941719

Sequence Coding Region

22938609..22938791,22938944..22939238,22939359..22939471,22939584..22939768,22939909..22940056
,22940152..22940430,22940512..22940616,22940791..22941033,22941573..22941647

Expression

GEO Profiles:Os10g0567400

Genome Context

<gbrowseImage1> name=NC_008403:22938211..22941719 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:22938211..22941719 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgaccactgtggcatcgctgtctttgctgccgcacttgctcatcaagccttccttcaggtgttgctccagaaagggtgttggtagatatggaggaatcaaggtgtatgcggtgctcggtgatgatggagctgactatgcaaagaacaacgcatgggaggccttgttccatgtcgatgacccggggccaagggttccaattgcaaaaggcaagttcttggatgtcaaccaagctcttgaggtggtccggttcgatatccagtattgcgattggagggcgcggcaggacctcctcaccatcatggttcttcacaacaaggtggtagaggttcttaatcctttagcaagggagttcaagtcaattggaaccttgaggaaagagcttgcagaattacaggaagaattggcaaaagctcacaatcaggttcatctgtcggaaactagagtatcatctgcccttgataagttggcacaaatggagacccttgtcaacgacagactgttgcaagatggaggctctagcgcatctacagccgagtgcacttcccttgctccaagcacgtcatcagcgtcccgtgttgtaaacaagaaacctcctcgccggagtctgaacgtgtctggtccagtgcagccatacaatcccagtctgaagaacttctggtacccagttgctttctccagtgacctaaaagacgatacaatggtgccaatagattgttttgaggagcagtgggtaattttccgaggaaaggatgggagacctggatgtgttatgaacacatgtgctcacagagcttgccctcttcatcttggctcagttaatgagggcagaatccaatgcccttaccatggttgggagtattcaactgatggaaaatgtgagaaaatgccatccacaaagatgctcaacgtgcgcatccggtcattaccatgctttgagcaagaaggaatggtttggatatggcctggcaatgacccaccgaagtcgactatcccttctctgctgcctccttcaggatttacaattcacgcagagatagtgatggagctaccagtggagcatggacttcttctggacaatctattagatcttgctcatgctccttttactcatacatccacctttgccaagggttggagtgttccaagcttggtgaagttcttgacaccttcatctgggcttcaaggatactgggatccatacccgatcgacatggaatttcgaccaccatgcatggtgttgtcaaccattggcatctcaaagcctggaaaactagaggggaagagcaccaagcaatgttcgacgcatctccaccagctccatatctgtttgccctcctctaggaataaaaccaggctgctctaccggatgtctctcgacttcgctccatggatcaagcatgtccctttcatgcatatactatggtcacattttgctgagaaggtcttgaatgaggatcttcgactcgtgctcgggcagcaagaacggatgatcaatggcgcaaatgtctggaactggccagtatcatatgacaagcttggtatccggtatcggttgtggagagacgccattgagaggggagtagacaggttgccattcagtaaccaaagtgagagtggatcatag</cdnaseq>

Protein Sequence

<aaseq>MTTVASLSLLPHLLIKPSFRCCSRKGVGRYGGIKVYAVLGDDGA DYAKNNAWEALFHVDDPGPRVPIAKGKFLDVNQALEVVRFDIQYCDWRARQDLLTIMV LHNKVVEVLNPLAREFKSIGTLRKELAELQEELAKAHNQVHLSETRVSSALDKLAQME TLVNDRLLQDGGSSASTAECTSLAPSTSSASRVVNKKPPRRSLNVSGPVQPYNPSLKN FWYPVAFSSDLKDDTMVPIDCFEEQWVIFRGKDGRPGCVMNTCAHRACPLHLGSVNEG RIQCPYHGWEYSTDGKCEKMPSTKMLNVRIRSLPCFEQEGMVWIWPGNDPPKSTIPSL LPPSGFTIHAEIVMELPVEHGLLLDNLLDLAHAPFTHTSTFAKGWSVPSLVKFLTPSS GLQGYWDPYPIDMEFRPPCMVLSTIGISKPGKLEGKSTKQCSTHLHQLHICLPSSRNK TRLLYRMSLDFAPWIKHVPFMHILWSHFAEKVLNEDLRLVLGQQERMINGANVWNWPV SYDKLGIRYRLWRDAIERGVDRLPFSNQSESGS</aaseq>

Gene Sequence

<dnaseqindica>2929..3111#2482..2776#2249..2361#1952..2136#1664..1811#1290..1568#1104..1208#687..929#73..147#gaggaaaaatatggggagtatttgtgcgtttttatttttgtttttgggtcgcactgttcgatcgtagcatccatgaccactgtggcatcgctgtctttgctgccgcacttgctcatcaagccttccttcaggtgttgctccagaaaggtgagttcttcttgttgttccttgaatctgtttttgttgttgttgtttggcgattcttgaatttgttttggggtatctggcgatgggaggaaccatgtttcttgtttggtttttgggttcaggtggccattcttgatgaaaaactgagtgtttgagtttgagcagtgcaatggagttaccatttttgttcttctgattggattctttgtgatggttgatgtttttgttcagacaatggtttcaaggttctgtgattcttcagaccccatatcttaaaacctgttgtattgaagtaagcaaaaaaacaaatcttgatcaaggacagcctagttgccaatttttctttgcaaatctgaatgcaattcaatctctttcttccagcaaatgcgtgcagctttcccccagtaaccacaggcttatctctgacactgatttaactagattttgctaatctctttgatactagtttgtctgctaaaatagagtgcatgtgaggttgatgaaaattgatggtgaccttgctgattgaaactacacagggtgttggtagatatggaggaatcaaggtgtatgcggtgctcggtgatgatggagctgactatgcaaagaacaacgcatgggaggccttgttccatgtcgatgacccggggccaagggttccaattgcaaaaggcaagttcttggatgtcaaccaagctcttgaggtggtccggttcgatatccagtattgcgattggagggcgcggcaggacctcctcaccatcatggttcttcacaacaaggtaggaagcattggacaagtcacaagttcagagaagaggtcaaagctttcatagtctgaattttacagatcatgggattcaaaattggactgcatactgaataatgcttgaggttgaagtttcggatgactgacataggttaacttaaatgaatttttgaacattgaaatgcaggtggtagaggttcttaatcctttagcaagggagttcaagtcaattggaaccttgaggaaagagcttgcagaattacaggaagaattggcaaaagctcacaatcaggtattgtactttcaggagacaggagccaaatgaaaaacttcaatattatatggattctgatgttttacatgtctaatccaggttcatctgtcggaaactagagtatcatctgcccttgataagttggcacaaatggagacccttgtcaacgacagactgttgcaagatggaggctctagcgcatctacagccgagtgcacttcccttgctccaagcacgtcatcagcgtcccgtgttgtaaacaagaaacctcctcgccggagtctgaacgtgtctggtccagtgcagccatacaatcccagtctgaagaacttctggtacccagttgctttctccagtgacctaaaagacgatacaatggtaaaaacaacgtgcgattcaggcatttttttacgaggtcagagttagcagttgcagaaacttatgtttatttgatgtggtttgcgcattctcaggtgccaatagattgttttgaggagcagtgggtaattttccgaggaaaggatgggagacctggatgtgttatgaacacatgtgctcacagagcttgccctcttcatcttggctcagttaatgagggcagaatccaatgcccttaccatggtaagaaaagacagctttacatgaactttcatttctgcatgcttccgcatttatttctgaagtcttcagatgaaaatttgccaacagagagaagttgcgaaagtagtatttcagtttttttttgttttcataaccttcaggttgggagtattcaactgatggaaaatgtgagaaaatgccatccacaaagatgctcaacgtgcgcatccggtcattaccatgctttgagcaagaaggaatggtttggatatggcctggcaatgacccaccgaagtcgactatcccttctctgctgcctccttcaggatttacaattcacgcagaggtaaaaggagatcatgtcatgctgcagcaaccatactatgtggaactgtcctgtgcatttcaagatttttactggactgaaaagtaatggaattgttcttgatcatcaacagatagtgatggagctaccagtggagcatggacttcttctggacaatctattagatcttgctcatgctccttttactcatacatccacctttgccaagggttggagtgttccaaggtatttacatacatatattttcacagccatgtggaattcttttttttttttttagaaaatggatagccatgtggaaatgtcttcagaaatcatcatgctgatgctatgttcatttcccagcttggtgaagttcttgacaccttcatctgggcttcaaggatactgggatccatacccgatcgacatggaatttcgaccaccatgcatggtgttgtcaaccattggcatctcaaagcctggaaaactagaggggaagagcaccaagcaatgttcgacgcatctccaccagctccatatctgtttgccctcctctaggaataaaaccaggctgctctaccggatgtctctcgacttcgctccatggatcaagcatgtccctttcatgcatatactatggtcacattttgctgagaaggtgagtccgaaaaattcagagcaacttcatactaaactgttgtccatctcatgtcattacagtttgcacctgactatagtatgcggttacctttgttttgcatactgtcctctatacaacatctataataatcttgtatgatctttctgcaggtcttgaatgaggatcttcgactcgtgctcgggcagcaagaacggatgatcaatggcgcaaatgtctggaactggccagtatcatatgacaagcttggtatccggtatcggttgtggagagacgccattgagaggggagtagacaggttgccattcagtaaccaaagtgagagtggatcatagtagctgcattgccaatagcctcttttcaattcttgtcgtatttcttggcgagatgaagatgaagatgaagatgatgatggccagaactagtcagtggatgtatatgcacagtttgtttaggcgtgcgtccctgcatggttggttcaccatctccctgagcttcgttgcagattgaattgggttctggagaggaaaggctaatggaaggagagaatgataggcgacgtcattctgtgtaattttaagtgtacactagcgacagcatcacgggatgcaattgtaatctgaggttgatttgtttttcttcttttttttttcctccccttttacccatgtaaaagtcgatcgcatgtcacgctatgatgcatatatatgatcatactattgattattgagcc</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0567400, RefSeq:Os10g0567400