Os11g0523700

From RiceWiki
Revision as of 05:30, 3 June 2014 by Huanghs (talk | contribs)
Jump to: navigation, search

Gene Os11g0523700,namely OsICE1, is Inducer of CBF Expression 1 and involved in cold acclimation.

Annotated Information

Function

This gene encodes a inducer of CBF expression 1 named OsICE1.Cold stress on crops results in severe yield losses through growth retardation and irreversible damage. Recently, Inducer of CBF Expression 1 (ICE1) was identified as the master regulator inducing dehydration responsive element binding protein/C-repeat binding factor (DREB/CBF)-type transcriptional factors involved in the signaling of cold and osmotic stress in Arabidopsis. Chilling stress on rice seedlings induced two ICE-related proteins with molecular masses of approximately 55 and 40 kDa. OsICE homologs function in transcriptional regulation at upstream of a cold-stress-induced transcription factor cascade involving OsDREB1B and OsHsfA3, leading to cold acclimation, possibly involving trehalose synthesis.

Expression

Cold stress had little or no effect on the expression of OsICE1 and OsICE2. Semi-quantitative RT-PCR indicated that both were constantly expressed, but that cold stress sequentially upregulated OsDREB1B, rice heat shock factor A3 (OsHsfA3), and trehalose-6-phosphate phosphatase (OsTPP1). Trehalose treatment enhanced the cold tolerance of seedlings.

Evolution

Cold stress on crops results in severe yield losses through growth retardation and irreversible damage. Recently, Inducer of CBF Expression 1 (ICE1) was identified as the master regulator inducing dehydration responsive element binding protein/C-repeat binding factor (DREB/CBF)-type transcriptional factors involved in the signaling of cold and osmotic stress in Arabidopsis. To examine whether rice ICE homologs function in cold acclimation via regulation of rice DREB homologs in response to cold stress, we assessed a polypeptide epitope containing an ICE-specific motif. Chilling stress on rice seedlings induced two ICE-related proteins with molecular masses of approximately 55 and 40 kDa. These sizes are consistent with those predicted for OsICE1 and OsICE2, respectively. In contrast to the proteins, cold stress had little or no effect on the expression of OsICE1 and OsICE2. Semi-quantitative RT-PCR indicated that both were constantly expressed, but that cold stress sequentially upregulated OsDREB1B, rice heat shock factor A3 (OsHsfA3), and trehalose-6-phosphate phosphatase (OsTPP1). Trehalose treatment enhanced the cold tolerance of seedlings. These results suggest that OsICE homologs function in transcriptional regulation at upstream of a cold-stress-induced transcription factor cascade involving OsDREB1B and OsHsfA3, leading to cold acclimation, possibly involving trehalose synthesis.

Labs working on this gene

  • Graduate School of Bioresource and Bioenvironmental Sciences, Kyushu University, Fukuoka 812-8581, Japan;
  • Department of Bioresource Sciences, Faculty of Agriculture, Kyushu University, Fukuoka 812-8581, Japan;
  • School of Agriculture, Kyushu University, Fukuoka 812-8581, Japan

References

1. Junya Nakamura;Takashi Yuasa;Tran Thi Huong;Keisuke Harano;Sho Tanaka;Tomoe Iwata;Thuy Phan;Mari Iwaya. Rice homologs of inducer of CBF expression (OsICE) are involved in cold acclimation. Plant Biotechnology, 2011, 28(3): 303-309

Structured Information

Gene Name

Os11g0523700

Description

Similar to Transcription factor ICE1 (Inducer of CBF expression 1) (Basic helix- loop-helix protein 116) (bHLH116) (AtbHLH116)

Version

NM_001074519.2 GI:297611916 GeneID:4350609

Length

3209 bp

Definition

Oryza sativa Japonica Group Os11g0523700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 11

Location

Chromosome 11:20749846..20753054

Sequence Coding Region

20749903..20750994,20751889..20752116,20752352..20752522,20752642..20752725

Expression

GEO Profiles:Os11g0523700

Genome Context

<gbrowseImage1> name=NC_008404:20749846..20753054 source=RiceChromosome11 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008404:20749846..20753054 source=RiceChromosome11 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgctgccgcggtttcacggcgccatgtggatgcaggacgacggcggcggcgaccaagaacacgggcaggcggcgccgcctgggcaggagcagcaccaccacgaccagcatctcatggcgttggcggccgcggccgcgggcggcgccgggttcggcgcggcgcaggcgccggcgccgctgctcgatgaggactggtacttcgacgcggcgggtggtggtggtggtggcgcgcatgggtccatgatgctgggtttgtcgtccgtccatggcgggattggggcggggacgtctggtggtgggcatgggcagcagttctcgctgctcaacatgggcgccgcggccgcgccgttcgacgtctccgggttcgacctcgggatcgcctgcggcggcgttggcggcggcggcgacgtggtgtcgtttcttggcggcgggaacgcgtcgaacaccgcgctgctccccgtcgggaacgcggggttcctcggcacgttcggcgggttcggcaccgcggcgtcccaaatgccggagttcggcgggctcgccgggttcgacatgttcgacgcgggcgccgtgaacaccgggggcagctcctcctcctcgtcggcggcggcggcggcggcgtccgcctcggcgcacgtgagcaacaccgcgccgttctccgggcgcggcaaggcggcggtgctgcggccgctggatatcgtcccgcccgtgggcgcgcagccgacgctgttccagaagcgcgcgctccgccgcaacgccggcgaggacgacgacgacaagaagcgcaaggccgccgcgggcgcgggcgcgggcgcgctgtccgccgacggcgccgacatggtgctcgacgacggcgacgacgacggcctcagcatcgacgcgtcgggcggcctcaactacgactccgaggacgccaggggcggcgaggacagcggcgccaagaaggagtcgaacgccaacagcacggtcaccggcgacgggaaggggaagaagaaggggatgccggccaagaacctcatggcggagcgccgccgccggaagaagctcaacgaccgcctctacatgctccgctccgtcgtgcccaagatcagcaagatggacagggcttccattctcggcgacgcgattgagtacctgaaggagctgctgcagaagatcaatgatcttcagaatgagctcgagtcgtcccccgcgacgtcgtcattgcctccaacacccacaagcttccatcccctgacaccgacgctgcccacattgccgtcccgcatcaaggaagagatctgcccaagtgcattgccaagccccactggacaacagccaagggttgaggttaggctgagggaaggccgggctgtcaatatccacatgttctgtgctcggaggcccggtctactgctctctgccatgagggccgtcgaaggccttggtctcgatgtccagcaagctgtaatcagttgcttcaatggctttacgttggatatttttaaggctgagcaatgcaaggacggccctgggctgttgcctgaagaaatcaaggccgttctgatgcaatccgccgggttccataccatgatctag</cdnaseq>

Protein Sequence

<aaseq>MLPRFHGAMWMQDDGGGDQEHGQAAPPGQEQHHHDQHLMALAAA AAGGAGFGAAQAPAPLLDEDWYFDAAGGGGGGAHGSMMLGLSSVHGGIGAGTSGGGHG QQFSLLNMGAAAAPFDVSGFDLGIACGGVGGGGDVVSFLGGGNASNTALLPVGNAGFL GTFGGFGTAASQMPEFGGLAGFDMFDAGAVNTGGSSSSSSAAAAAASASAHVSNTAPF SGRGKAAVLRPLDIVPPVGAQPTLFQKRALRRNAGEDDDDKKRKAAAGAGAGALSADG ADMVLDDGDDDGLSIDASGGLNYDSEDARGGEDSGAKKESNANSTVTGDGKGKKKGMP AKNLMAERRRRKKLNDRLYMLRSVVPKISKMDRASILGDAIEYLKELLQKINDLQNEL ESSPATSSLPPTPTSFHPLTPTLPTLPSRIKEEICPSALPSPTGQQPRVEVRLREGRA VNIHMFCARRPGLLLSAMRAVEGLGLDVQQAVISCFNGFTLDIFKAEQCKDGPGLLPE EIKAVLMQSAGFHTMI</aaseq>

Gene Sequence

<dnaseqindica>58..1149#2044..2271#2507..2677#2797..2880#gcacctctgcatctctgccatctccttccccaccccaccgccattgccgccgcggcgatgctgccgcggtttcacggcgccatgtggatgcaggacgacggcggcggcgaccaagaacacgggcaggcggcgccgcctgggcaggagcagcaccaccacgaccagcatctcatggcgttggcggccgcggccgcgggcggcgccgggttcggcgcggcgcaggcgccggcgccgctgctcgatgaggactggtacttcgacgcggcgggtggtggtggtggtggcgcgcatgggtccatgatgctgggtttgtcgtccgtccatggcgggattggggcggggacgtctggtggtgggcatgggcagcagttctcgctgctcaacatgggcgccgcggccgcgccgttcgacgtctccgggttcgacctcgggatcgcctgcggcggcgttggcggcggcggcgacgtggtgtcgtttcttggcggcgggaacgcgtcgaacaccgcgctgctccccgtcgggaacgcggggttcctcggcacgttcggcgggttcggcaccgcggcgtcccaaatgccggagttcggcgggctcgccgggttcgacatgttcgacgcgggcgccgtgaacaccgggggcagctcctcctcctcgtcggcggcggcggcggcggcgtccgcctcggcgcacgtgagcaacaccgcgccgttctccgggcgcggcaaggcggcggtgctgcggccgctggatatcgtcccgcccgtgggcgcgcagccgacgctgttccagaagcgcgcgctccgccgcaacgccggcgaggacgacgacgacaagaagcgcaaggccgccgcgggcgcgggcgcgggcgcgctgtccgccgacggcgccgacatggtgctcgacgacggcgacgacgacggcctcagcatcgacgcgtcgggcggcctcaactacgactccgaggacgccaggggcggcgaggacagcggcgccaagaaggagtcgaacgccaacagcacggtcaccggcgacgggaaggggaagaagaaggggatgccggccaagaacctcatggcggagcgccgccgccggaagaagctcaacgaccgcctctacatgctccgctccgtcgtgcccaagatcagcaaggtcaggattccttctcctgctctcccaattctcatgaaatctctcaaaaagttcttaattctggcgaattttagggaatgcgtaattttggtcgaattttgtgtgttttctttgccatgaagagtggaaaggggaaaataaattctgtggttagcattgctaccaatattcttgtatgatataagttctacttatgatttgaatttctgaacttcaagtatatgagtttgatgaactatttttcatagccaacggcatgcatttcagttgcgattgttcatgtcaaattgtggatatacaccaactttggaaggattttgtttcatttacagaaattctagcttctagttctatgttctgttaggaactttgattgtctttaggaaggagtagatagaatgacttcaattgtcctagtcgttgctggttacaagaattaaatgtgacttctgttcataagatgtctgcatgggaatttttactgtccatcacactgtcactacctgtctctgctgcctcctgttcagtttccagtcaatcgagtagacttgtagacagattgcagaaaaacaataaaaagccatgccctacataactgtgttttagtttagttttagtagtcagagaatctttcagtattttgttgtataaaaaatgagttgctctattttcttttactaccttttattttgtgttgagacagtgggagagaatgagttagtatactgcactgcatcatctgttatctgttcctgaatactgacattgtttcctttttcacatttcctcttgctggtactactaatatcattcatatgaaagcaattctatagtgatgcattatacttgtgatgatttagcaataagatgattatatgtgtttgcaattggtagatggacagggcttccattctcggcgacgcgattgagtacctgaaggagctgctgcagaagatcaatgatcttcagaatgagctcgagtcgtcccccgcgacgtcgtcattgcctccaacacccacaagcttccatcccctgacaccgacgctgcccacattgccgtcccgcatcaaggaagagatctgcccaagtgcattgccaagccccactggacaacagccaagggtcagtatctcctatcttctgaatgtcaccagatgagagtatagcttgtttcagatgagataacctgcatatcagaaaaggaattgcattgtcattggtataattatgcggttgataagtagtagacagtaaaatgtgcaatgtggttgatttatgcatcagattttctaactattgccaacctgatcaagcatttgacacactttctgacctttttttctacatcttgcaaaaggttgaggttaggctgagggaaggccgggctgtcaatatccacatgttctgtgctcggaggcccggtctactgctctctgccatgagggccgtcgaaggccttggtctcgatgtccagcaagctgtaatcagttgcttcaatggctttacgttggatatttttaaggctgaggtaatgcataaaattctatgctcattttcagaactagcatttcgatatagtatcctgaaggatagtggtgatggtactgaaactcaatttgaactgacaattgctcaattttaatgcagcaatgcaaggacggccctgggctgttgcctgaagaaatcaaggccgttctgatgcaatccgccgggttccataccatgatctaggacaggagagctcaatcaaactccaaaggacagagtagctcaggaattgacaaagtaccggtgtttcctggtcatgtggcattttcgacagaaggaagttcctctttttagtagttttagacctgctcagggcttgctgaaccagtttatcttctagtatttagagtccccaaaaaaaataatgtcagtagtctcttggtgctttaacattgtgttttgaaaccttctgcctgttttttttacttcccggtacatgttttcgtcttgtgtaagtctgaagatgaattcctatcaattaacaggcaaagaaacaggatcattccaagaac</dnaseqindica>

External Link(s)

NCBI Gene:Os11g0523700, RefSeq:Os11g0523700