Os03g0182800

From RiceWiki
Revision as of 08:56, 3 June 2014 by Linyanxiang (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

OsDERF1 is a novel ERF protein of unknown function Multiple factors, including water potential and osmotic adjustment, affect plant water status and drought tolerance. To elucidate the molecular basis underlying drought response, transcript levels of genes were screened under drought conditions. Using expression data for stress treatment in rice seedlings (http://www.ricearray. org), 12 drought-responsive ERF genes (DERF) were identified (Table S1, GEO accession number GSE26280). One of the DERF genes, OsDERF1 (Os08g35240), located in rice chromosome 8, encodes a 243-amino-acid protein with predicted molecular mass of 23.8 kDa. Amino acid analysis indicated that the putative protein contains a typical ERF/AP2 domain at 26–91thamino acids, an activation domain at 161–180thamino acids, and a nuclear localization signal at 25–34thamino acids.

Expression

The expression of OsDERF1 was highly induced (about fourfold) by ACC treatment at 1 h, and reached maximum induction at 2 h, then decreased (Figure 1A). And the transcripts of OsDERF1 in response to dehydration were quickly peaked at 0.5 h then decreased. Interestingly, the transcripts of OsDERF1 showed a second increase and peaked after dehydration induction for 3 h (Figure 1B). In addition, the expression of OsDERF1 obviously increased and peaked after ABA treatment for 1 h (Figure 1C). Further analysis revealed that OsDERF1 expression did not significantly alter when seedlings were subjected to salt and cold (data not shown), indicating that OsDERF1 might be associated with ethylene- and ABA-related drought response.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

1 Biotechnology Research Institute, Chinese Academy of Agricultural Sciences, Beijing, China, 2 National Key Facility of Crop Gene Resources and Genetic Improvement,Beijing, China, 3 National Center for Plant Gene Research (Beijing), Beijing, China

References

Transcriptional Activation of OsDERF1 in OsERF3 and OsAP2-39 Negatively Modulates Ethylene Synthesis and Drought Tolerance in Rice Liyun Wan1,2,3., Jianfei Zhang1,2,3., Haiwen Zhang1,2,3, Zhijin Zhang1,2,3, Ruidang Quan1,2,3, Shirong Zhou1,2,3, Rongfeng Huang1,2,3*

Structured Information

Gene Name

OsERF3

Description

Similar to Ethylene responsive element binding factor3 (OsERF3)

Version

NM_001055711.1 GI:115451150 GeneID:4331843

Length

1992 bp

Definition

Oryza sativa Japonica Group Os03g0182800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:4322061..4324052

Sequence Coding Region

4322456..4322739,4323187..4323609,4323725..4323998

Expression

GEO Profiles:OsERF3

Genome Context

<gbrowseImage1> name=NC_008396:4322061..4324052 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:4322061..4324052 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgtgcggcggtgcaatcctcgccgatttcaccccggcgagggtgccccggcggctgaccgccgccgagctcctgccggtgaccccgactccccccgccgccgagaggagaaccacccggaagcgcaagtccgacgtcgacttcgaggcggagttcgagcttttcgaggacgacgacgacgacgatgagttcgagctttccgacgatggcgacgagagtttggccgtgtcatgtgtgtcgtcccccaagtcgaaggcagtaccttcgttttctttttcgtcggatgtctcctcgagctccaggccgcggcggcgcgtggcggcggcggcggccggtcgtcggaaggcgagcaagaagagcaagtacaggggcgtccggcgccggccgtcggggaggttcgcggcggagatcagggaccccaagaaggggcggcgcgtgtggctcggcacgtacggcagcgccgaggaggccgccatggcctacgaccgcgaggcccgccgcatccgcggcaagggcgcgaggctcaacttcccccgcgacggcgatggctcccctcgccggagtaacgaccggccctgctggaccatcgacctcaacctccccgcggcggccgtctccggtgacgacgacgacgccatggccgtcgacgccgcagacgcagacgcaggcagtgctggccgtgcagcagcctatgcagatcaagaagcactgagcgcggcaaagtgcaagatcaagcagtgtcctcgcgacgaacagatggcgagcgccacacctgagctcatggaggaggacgcgagcagcagcagaaacatggtgcccctgtccatggcgctgcagctgcagtatgcggcgatgatcgccgaatgcgaccgcgagatggaggagatcgccgccgtggagagggacctcgagaggcgcaggaggcaggtgttcgagcgcagaggccacctggtcaggcaggcctctcttctgctcgactga</cdnaseq>

Protein Sequence

<aaseq>MCGGAILADFTPARVPRRLTAAELLPVTPTPPAAERRTTRKRKS DVDFEAEFELFEDDDDDDEFELSDDGDESLAVSCVSSPKSKAVPSFSFSSDVSSSSRP RRRVAAAAAGRRKASKKSKYRGVRRRPSGRFAAEIRDPKKGRRVWLGTYGSAEEAAMA YDREARRIRGKGARLNFPRDGDGSPRRSNDRPCWTIDLNLPAAAVSGDDDDAMAVDAA DADAGSAGRAAAYADQEALSAAKCKIKQCPRDEQMASATPELMEEDASSSRNMVPLSM ALQLQYAAMIAECDREMEEIAAVERDLERRRRQVFERRGHLVRQASLLLD</aaseq>

Gene Sequence

<dnaseqindica>1314..1597#444..866#55..328#cccgcgtcgcgccatagcgacgtctctcccggagaaagaagagcgcgccgcgccatgtgcggcggtgcaatcctcgccgatttcaccccggcgagggtgccccggcggctgaccgccgccgagctcctgccggtgaccccgactccccccgccgccgagaggagaaccacccggaagcgcaagtccgacgtcgacttcgaggcggagttcgagcttttcgaggacgacgacgacgacgatgagttcgagctttccgacgatggcgacgagagtttggccgtgtcatgtgtgtcgtcccccaagtcgaaggcagtaccttcgttttcttgtacgatgagatggagaaatcttgcctgctttcttgaaggattttcacctgacggcaacctgaactttacacgatttcttctcctgctgttgatttcatcgatcgccggcggcagtttcgtcggatgtctcctcgagctccaggccgcggcggcgcgtggcggcggcggcggccggtcgtcggaaggcgagcaagaagagcaagtacaggggcgtccggcgccggccgtcggggaggttcgcggcggagatcagggaccccaagaaggggcggcgcgtgtggctcggcacgtacggcagcgccgaggaggccgccatggcctacgaccgcgaggcccgccgcatccgcggcaagggcgcgaggctcaacttcccccgcgacggcgatggctcccctcgccggagtaacgaccggccctgctggaccatcgacctcaacctccccgcggcggccgtctccggtgacgacgacgacgccatggccgtcgacgccgcagacgcagacgcaggcagtgctggccgtgcagcagcctatgcaggtactaccacctcggaggatatctcaagatgtattaatacgtgatatatcactttgtaaatatgcatgtttaaaattaactcctacatctcaaaataaaataaaacaatttaattgtgaatatacgttaactagttatagtttaatttatttttttttcgtttttatttttttcgttgcgggagtagaagttgaatttgaatttgcatgtgtgctggcggagaaacttggctcgtaggctcgtagcatggagcattgccctgttcgcatcatatcatacggttgagctcgatttttgcgaaagaaagaaaggattccaatattctcactgatgaatgatgatcaaggttgataaaatgagcgaactcgatcaaaccaaaccaacaaatttcgaagaatcaagtagatttactaatgtattggcgttgttggcttgttgccgtcgcagatcaagaagcactgagcgcggcaaagtgcaagatcaagcagtgtcctcgcgacgaacagatggcgagcgccacacctgagctcatggaggaggacgcgagcagcagcagaaacatggtgcccctgtccatggcgctgcagctgcagtatgcggcgatgatcgccgaatgcgaccgcgagatggaggagatcgccgccgtggagagggacctcgagaggcgcaggaggcaggtgttcgagcgcagaggccacctggtcaggcaggcctctcttctgctcgactgacgatcttgctgaactgaactctgaatgtttgagcttgtctgaagtctgaactctgcactatgccatatggtgtttcaccttcactgtgaggctgacatgtgggccagacgtccgtttgccttgcttgcttttgagctgcaactgggcgttgtgctgcaagcctgcaaagtgcctgtgtaaagtttgtgggattgtgtgtgtggatcttgtatccttgtgactttgcaagctttaattttgtgaggaacaatagtattttagattggtgtgtaaaatatagaaataaataatagtagcaactaaattttggttttcagctcttcatcagatggtttgtcatgggaacaaaatttcaaacatgagcaaattaaggtcatgttattatcaattgtgat</dnaseqindica>

External Link(s)

NCBI Gene:OsERF3, RefSeq:Os03g0182800