Os10g0467800

From RiceWiki
Revision as of 09:56, 3 June 2014 by Wenqian (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Cellulose is the major component in wood, which is present universally in plant cell walls and provides mechanical strength to the plant. Cellulose accounts for about 20 % and 50 % of the primary and secondary cell walls in higher plants, respectively. Membrane-bound cellulose synthase enzyme complexes (CelS) are believed to play a key role in the biosynthesis of cellulose[1]. These complexes are discernible as hexameric rosettes under freeze-fracture electron microscopy and consist of 36 cellulose synthase (CesA) proteins per rosette.The AtCesA7 gene encodes a essential subunit which is required for the correct assembly of the enzyme responsible for cellulose synthesis. Cellulose is a homogenous polymer of β-1,4-glucan synthesized from UDP-Glc. Plant CesA (cellulose synthase catalytic subunit) genes were first isolated by random sequencing of cotton (Gossypium hirsutum) expressed sequence tags . Based on mutant analyses, characterization of six CesA genes of Arabidopsis has been reported. But cellulose biogenesis is a complex process, which still requires ongoing study to comprehend completely its pathways and mechanisms. Even with the completion of the Arabidopsis thaliana genome sequencing project, researchers still struggle to understand the biogenesis of cellulose in A.thaliana,let alone other plants that are less well studied.

Expression

OsCesA7 cDNA,including 9 exons, encoding a 1063 amino acid composition of cellulose synthase catalytic subunit. OsCesA7 contains a UDP - Glc motif,QxxRW motif,P - CR conservative domain,VR1 and VR2 variable region,the RING finger motif. The rsw1 mutation in AtCesA1 causes a reduction of cellulose synthesis, when grown at the nonpermissive temperature, resulting in disassembly of the rosette complexes,widespread morphological abnormalities, and the accumulation of noncrystalline β-1,4-glucan. The irx3 mutant of AtCesA7 shows a reduction of cellulose content in the stem and a defect in the secondary cell wall formation in xylem that causes collapse of xylem elements. These results indicate that AtCesA1 and AtCesA7 contribute to cellulose syntheses in the properly developed primary and secondary cell wall,respectively.

Based on the sequences shown in Figure 3, phylogenetic relationships of CesA genes from higher plants were examined (Fig. 4). Three rice CesA genes were considered to function to synthesize cellulose in the secondary cell walls responsible for the overall strength of the plant, judging from the brittle culm phenotype (Fig. 1) exhibited by their respective mutants (Fig. 2).

The phylogenetic relationships between the three rice CesA genes and all of the Arabidopsis genes indicated that OsCesA9, OsCesA4, and OsCesA7 are the functional analogues for AtCesA7, AtCesA8, and AtCesA4, respectively. This result strongly suggests that these three rice CESA proteins, like the three Arabidopsis CESA proteins, make a complex essential for cellulose synthesis in secondary cell wall. Two cotton CesA genes (GhCesA1 and -3) that are considered to be members of secondary wall-forming genes belong to the same group including OsCesA4 and AtCesA8. In maize, only eight complete amino acid sequences have been determined, and no CesA genes analogous to the three rice/Arabidopsis genes have been isolated, probably due to low abundance of the cDNAs[2].

Evolution

Analyze the cellulose synthase gene family of rice by using the DNAStar and MEGA software, The results show that cellulose synthase gene family is formed by the cellulose synthase family which is make up of eleven members and the cellulose synthaselike family which including thirtyfour members, By Protein sequence alignment and phylogenetic analysis,we know that the family of CesA can divided into three groups .the member CesA7 can be seen as the transition of the group one and group two ,The family of Csl can be divided into six groups, This results laiding a foundation on origin, evolution and function research of ccellulose synthase gene family.

Labs working on this gene

In 2000, Richmond and Somerville identified 10 CesA genes and 31 cellulose synthases-like (Csl) genes in Arabidopsis, which were further classified into one CesA family and six Csl families (CslA/B/C/D/E/G) based on phylogenetic analyses . Since then, the whole CesA and Csl gene repertoire has been cataloged in fully sequenced plants, including rice , poplar and the moss Physcomitrella patens . Additional CesA and Csl genes have also been found in diverse and not fully sequenced land plants such as maize , barley and pine; CesAs have been identified in streptophyte green algae such as Mesotaenium caldariorum and in red alga Porphyra yezoensis as well. Two additional Csl families (CslF and CslH) were found in these studies; together with the other six Csl families and one CesA family, they comprise the CesA superfamily.

The phylogenetic classification and the function of the CesA superfamily were reviewed by Lerouxel et al. in 2006 , and since then there have been a few updates in terms of the phylogenetic analyses of these important genes. Fincher et al. have found a new Csl family (CslJ) in cereals . Roberts and Bushoven have mined the P. pattens genomic and EST data and found CesA, CslA, CslC and CslD genes in this lower plant; their phylogenetic analyses revealed that seven P. patens CesA genes form a monophyletic clade by themselves and there are no one-to-one orthologs in the moss corresponding to the Arabidopsis CesA triplet subunits (CesA1/3/6 for the primary cell wall and CesA4/7/8 for the secondary cell wall). Furthermore, comprehensive phylogenetic analyses of the plant CesA superfamily by including CesAs from other organismal groups (e.g., bacteria, fungi and animals) indicated that plant CslA and CslC genes have a different origin than the remaining plant genes . Evidences have been reported that these remaining genes of the CesA superfamily were anciently acquired from cyanobacteria. It was proposed that the plant CslG genes evolved first, followed by the CslE, CslB, CesA and CslD/F genes. However, a more recent study could not find homologs of the CslG/E/B/H/F genes in P. patens, suggesting that these Csl families are narrowly distributed and unlikely to be the earliest evolved.

To date 17 plant and algal genomes have been fully or nearly fully sequenced, and their gene prediction and annotation are publicly available. The availability of these genomes and their annotated genes facilitates comparative genomic studies of plants, making it possible to address major plant biology questions in silico. Yanbin Yin et al. have performed comparative analyses of the CesA superfamily genes in the 17 sequenced plant and algal genomes. They defined CesA and Csl gene homologs across these genomes investigated the evolution of different Csl gene families,build a catalog of all the Csl genes and classified them phylogenetically. The gene structure, the evolutionary rate, and the distribution of the Csl families across different genomes are also studied.

References

  1. Saxena IM, Brown RM. Cellulose Biosynthesis: Current views and evolving concepts.Ann Bot. 2005;96:9–21.
  2. Peng L, Kawagoe Y, Hogan P, Delmer D (2002) Sitosterol-β-glucoside as primer for cellulose synthesis in plants.Science.295:147-150.

Cite error: <ref> tag with name "ref2" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref3" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref5" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref6" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref7" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref8" defined in <references> is not used in prior text.

Structured Information

Gene Name

Os10g0467800

Description

Similar to Cellulose synthase (Fragment)

Version

NM_001071346.1 GI:115482435 GeneID:4348853

Length

4512 bp

Definition

Oryza sativa Japonica Group Os10g0467800, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:17719262..17723773

Sequence Coding Region

17719294..17719507,17719609..17719736,17719852..17719921,17720009..17720165,17720266..17720878
,17721309..17721785,17721863..17722456,17722536..17722886,17722985..17723572

Expression

GEO Profiles:Os10g0467800

Genome Context

<gbrowseImage1> name=NC_008403:17719262..17723773 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:17719262..17723773 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacaccgcctccgtcaccggtggcgagcacaaggggaaggagaagacgtgccgggtgtgcggcgaggaggtggcggcgagggaggacgggaagccgttcgtggcgtgcgccgagtgcggcttcccggtgtgcaagccctgctacgagtacgagcgcagcgagggcacccagtgctgcccccagtgcaacacccgctacaagcgccacaaagggtgcccacgggtggaaggcgacgaggacgacggcggcgacatggacgacttcgaggaggagttccagatcaagagccccaccaagcagaaacccccccacgagcccgtcaacttcgacgtctactcggagaacggcgagcagccggcacagaagtggcgccctggaggcccggcgctctcttccttcaccggaagcgtggctgggaaggatctggagcaggagagggagatggagggtggcatggagtggaaggacaggatcgacaagtggaagacgaagcaggagaagcggggcaagctcaaccgcgacgacagcgacgacgacgacgacaagaacgacgacgagtacatgctgctcgcggaggcgaggcagccgctgtggaggaaggtgccgatcccgtcgagcaagatcaacccgtaccggatcgtgatcgtgctccggctggtggtgctctgcttcttcctcaagttccggatcacgacgccggcgatggacgcggtgccgctgtggctggcctcggtgatctgcgagctgtggttcgcgctgtcgtggatcctcgaccagctgcccaagtggtcgccggtgacgagggagacgtacctggaccggctggccctccggtacgagcgcgacggcgagccgtgccgcctggccccgatcgatttcttcgtcagcacggtggacccgctcaaggagccgcccatcatcaccgccaacaccgtgctgtccatcctcgccgtcgactaccccgtcgaccgcgtctcctgctacgtctccgacgacggcgcgtccatgctgctcttcgacacgctctccgagaccgccgagttcgcccgccggtgggtccccttctgcaagaagttcaccatcgagccccgcgcccccgagttctacttctcccagaagatcgactacctcaaggacaaggtccagcccaccttcgtcaaagaacgccgcgccatgaagagagagtatgaggagttcaaggtgaggataaacgcgctggtggcgaaggcgcagaagaagccggaggaagggtgggtgatgcaggacgggacgccatggccggggaacaacacgagggaccacccggggatgatccaggtgtacctgggcagccagggcgcgctcgacgtcgagggcagcgagctgccgcggctggtgtacgtgtcccgcgagaagcggcccggctacaaccaccacaagaaggccggcgccatgaactccctcgttcgcgtctccgccgtgcttaccaacgcccccttcatcctcaacctcgactgcgaccactacgtcaacaacagcaaggccgtccgcgaggccatgtgcttcctcatggacaagcagctcggcaagaagctgtgctacgtccagttcccccagcgcttcgacggcatcgaccgccacgatcgctacgccaaccgcaacaccgtcttcttcgacatcaacatgaaggggctggacgggatacaggggccggtgtacgtggggacggggacggtgttcaacaggcaggcgctgtacggatacgacccgccgcggccggagaagaggccgaagatgacgtgcgactgctggccgtcgtggtgctgctgctgctgctgcttcggcggggggaagcgcggcaagtcgcacaagaacaagaagggcggcggcggcggcgagggcggcggcctcgacgagccgcgccgcgggctgctcgggttctacaagaagaggagcaagaaggacaagctcggcggcggcgcggcgtcgctcgccggagggaagaaagggtaccggaagcaccagcgcgggttcgagctggaggagatcgaggagggcctcgaggggtacgacgagctggagcgctcgtcgctcatgtcgcagaagagcttcgagaagcggttcggccagtcgccggtgttcatcgcctccaccctcgtcgaggacggcggcctcccccagggcgccgccgccgaccccgccgccctcatcaaggaggccatccacgtcatcagctgcggctacgaggagaagaccgagtggggcaaggagattgggtggatctacgggtcggtgacggaggacatcttaacggggttcaagatgcattgccgtgggtggaagtcggtgtactgcacgccggcgagggcggcattcaaggggtcggcgcccatcaacctgtcggatcgtctgcaccaggtgctccggtgggcgctcggctccgtcgagatcttcatgagccgccattgcccgctctggtacgcctatggcggccgcctcaagtggctcgagcgcttcgcctacaccaacaccatcgtctaccccttcacctccattcccctcctcgcctactgcaccatccccgccgtctgcctcctcaccggcaagttcatcatccccacgcttaacaatttggcgagcatatggttcatagcgcttttcctgtcgatcatcgcgacgggggtgctggagctgcggtggagcggggtgagcatcgaggactggtggaggaacgagcagttctgggtgatcggcggcgtgtcggcgcacctgttcgccgtgttccagggcctcctcaaggtgctcggcggcgtggacaccaacttcacggtgacgtccaaggccgccgccgacgagaccgacgcgttcggcgagctctacctgttcaagtggacgacgctgctggtgccgccgacgacgctgatcatcatcaacatggtggggatcgtcgccggcgtgtcggacgccgtgaacaacgggtacgggtcgtggggcccgctgttcgggaagctcttcttctccttctgggtcatcctccacctctaccccttcctcaaggggctcatggggaggcagaaccggacgcccaccattgtcgtgctctggtccatcctcctcgcctccatcttctccctcgtctgggtcaggatcgaccccttcatccccaagcccaagggccccgtcctcaagccatgcggggtctcgtgctga</cdnaseq>

Protein Sequence

<aaseq>MDTASVTGGEHKGKEKTCRVCGEEVAAREDGKPFVACAECGFPV CKPCYEYERSEGTQCCPQCNTRYKRHKGCPRVEGDEDDGGDMDDFEEEFQIKSPTKQK PPHEPVNFDVYSENGEQPAQKWRPGGPALSSFTGSVAGKDLEQEREMEGGMEWKDRID KWKTKQEKRGKLNRDDSDDDDDKNDDEYMLLAEARQPLWRKVPIPSSKINPYRIVIVL RLVVLCFFLKFRITTPAMDAVPLWLASVICELWFALSWILDQLPKWSPVTRETYLDRL ALRYERDGEPCRLAPIDFFVSTVDPLKEPPIITANTVLSILAVDYPVDRVSCYVSDDG ASMLLFDTLSETAEFARRWVPFCKKFTIEPRAPEFYFSQKIDYLKDKVQPTFVKERRA MKREYEEFKVRINALVAKAQKKPEEGWVMQDGTPWPGNNTRDHPGMIQVYLGSQGALD VEGSELPRLVYVSREKRPGYNHHKKAGAMNSLVRVSAVLTNAPFILNLDCDHYVNNSK AVREAMCFLMDKQLGKKLCYVQFPQRFDGIDRHDRYANRNTVFFDINMKGLDGIQGPV YVGTGTVFNRQALYGYDPPRPEKRPKMTCDCWPSWCCCCCCFGGGKRGKSHKNKKGGG GGEGGGLDEPRRGLLGFYKKRSKKDKLGGGAASLAGGKKGYRKHQRGFELEEIEEGLE GYDELERSSLMSQKSFEKRFGQSPVFIASTLVEDGGLPQGAAADPAALIKEAIHVISC GYEEKTEWGKEIGWIYGSVTEDILTGFKMHCRGWKSVYCTPARAAFKGSAPINLSDRL HQVLRWALGSVEIFMSRHCPLWYAYGGRLKWLERFAYTNTIVYPFTSIPLLAYCTIPA VCLLTGKFIIPTLNNLASIWFIALFLSIIATGVLELRWSGVSIEDWWRNEQFWVIGGV SAHLFAVFQGLLKVLGGVDTNFTVTSKAAADETDAFGELYLFKWTTLLVPPTTLIIIN MVGIVAGVSDAVNNGYGSWGPLFGKLFFSFWVILHLYPFLKGLMGRQNRTPTIVVLWS ILLASIFSLVWVRIDPFIPKPKGPVLKPCGVSC</aaseq>

Gene Sequence

<dnaseqindica>33..246#348..475#591..660#748..904#1005..1617#2048..2524#2602..3195#3275..3625#3724..4311#gcccaccaacgtcgcttccccggcacctcaccatggacaccgcctccgtcaccggtggcgagcacaaggggaaggagaagacgtgccgggtgtgcggcgaggaggtggcggcgagggaggacgggaagccgttcgtggcgtgcgccgagtgcggcttcccggtgtgcaagccctgctacgagtacgagcgcagcgagggcacccagtgctgcccccagtgcaacacccgctacaagcgccacaaaggtaacatcatgtgttgtgtccatgtgatcaatcgcaatttagttcacaagatcgagcttgacaagaatgtctgtctgtctgtctcgatcgatcggtcgcagggtgcccacgggtggaaggcgacgaggacgacggcggcgacatggacgacttcgaggaggagttccagatcaagagccccaccaagcagaaacccccccacgagcccgtcaacttcgacgtctactcggtgagagctcaactcgactcgatcgatccatcgccattgatttctcactgcaattgctctgcaatcaagtgcttgtaaactgatgcgaaacctgtatacaacctttgtcttgcaggagaacggcgagcagccggcacagaagtggcgccctggaggcccggcgctctcttccttcaccggaagcggtcggtactcaaatcccgcaagaaattgcgtttcttggtgtaacaattcatctgaagatgtgtgtgtggattgctgtgaaattgcagtggctgggaaggatctggagcaggagagggagatggagggtggcatggagtggaaggacaggatcgacaagtggaagacgaagcaggagaagcggggcaagctcaaccgcgacgacagcgacgacgacgacgacaagaacgacgacgagtacatgctgtaagcttagctctccaaagatctatctatcgatcgacctcagatttttcaaatcttgtgaactttggcatgatcgtgatgatcgaatttctgcatgcaggctcgcggaggcgaggcagccgctgtggaggaaggtgccgatcccgtcgagcaagatcaacccgtaccggatcgtgatcgtgctccggctggtggtgctctgcttcttcctcaagttccggatcacgacgccggcgatggacgcggtgccgctgtggctggcctcggtgatctgcgagctgtggttcgcgctgtcgtggatcctcgaccagctgcccaagtggtcgccggtgacgagggagacgtacctggaccggctggccctccggtacgagcgcgacggcgagccgtgccgcctggccccgatcgatttcttcgtcagcacggtggacccgctcaaggagccgcccatcatcaccgccaacaccgtgctgtccatcctcgccgtcgactaccccgtcgaccgcgtctcctgctacgtctccgacgacggcgcgtccatgctgctcttcgacacgctctccgagaccgccgagttcgcccgccggtgggtccccttctgcaagaagttcaccatcgagccccgcgcccccgagttctacttctcccagaagatcgactacctcaaggacaaggtccagcccaccttcgtcaaagaacgccgcgccatgaaggtaaaccttctccactccatctgcgggttgagtgtcgtggatataccggattcaagggtttaatatattgttttaggcatttgtgttggggggaccgatatagccggttatttcgatccaaaattattttattttattttgaaaaaaaatgattaaaatttgaataaatattatcaaattcacaaaaatttgaaaaacatttaaaagtttcgtccgaaataatatcatatcaggttgtccaatagaactgaaatgtcaaaaattatgttatgtaattttgaaccctcattcaattggagcatctcgtgatcagtctgtttttggagatgtaggctatggctaaacttcgttaccgatatatcccttctcgatgttgtcatccagtttagatcgtctataagttttttaacacctactcttgatgtgacagagagagtatgaggagttcaaggtgaggataaacgcgctggtggcgaaggcgcagaagaagccggaggaagggtgggtgatgcaggacgggacgccatggccggggaacaacacgagggaccacccggggatgatccaggtgtacctgggcagccagggcgcgctcgacgtcgagggcagcgagctgccgcggctggtgtacgtgtcccgcgagaagcggcccggctacaaccaccacaagaaggccggcgccatgaactccctcgttcgcgtctccgccgtgcttaccaacgcccccttcatcctcaacctcgactgcgaccactacgtcaacaacagcaaggccgtccgcgaggccatgtgcttcctcatggacaagcagctcggcaagaagctgtgctacgtccagttcccccagcgcttcgacggcatcgaccgccacgatcgctacgccaaccgcaacaccgtcttcttcgacgtgagcactgccttcttctccggcgtgcgtgcgtcgcgccgtgacgtgagctaacgatggtgtcgtttgatgtgcagatcaacatgaaggggctggacgggatacaggggccggtgtacgtggggacggggacggtgttcaacaggcaggcgctgtacggatacgacccgccgcggccggagaagaggccgaagatgacgtgcgactgctggccgtcgtggtgctgctgctgctgctgcttcggcggggggaagcgcggcaagtcgcacaagaacaagaagggcggcggcggcggcgagggcggcggcctcgacgagccgcgccgcgggctgctcgggttctacaagaagaggagcaagaaggacaagctcggcggcggcgcggcgtcgctcgccggagggaagaaagggtaccggaagcaccagcgcgggttcgagctggaggagatcgaggagggcctcgaggggtacgacgagctggagcgctcgtcgctcatgtcgcagaagagcttcgagaagcggttcggccagtcgccggtgttcatcgcctccaccctcgtcgaggacggcggcctcccccagggcgccgccgccgaccccgccgccctcatcaaggaggccatccacgtcatcagctgcggctacgaggagaagaccgagtggggcaaggaggtaatccatcaaaaaatctccaccattttcaagctcgaggaagatgatcgaagctaaccaaaaatcaaaattcttgcagattgggtggatctacgggtcggtgacggaggacatcttaacggggttcaagatgcattgccgtgggtggaagtcggtgtactgcacgccggcgagggcggcattcaaggggtcggcgcccatcaacctgtcggatcgtctgcaccaggtgctccggtgggcgctcggctccgtcgagatcttcatgagccgccattgcccgctctggtacgcctatggcggccgcctcaagtggctcgagcgcttcgcctacaccaacaccatcgtctaccccttcacctccattcccctcctcgcctactgcaccatccccgccgtctgcctcctcaccggcaagttcatcatccccacggtaaagaaccaaccaagaacatcaaaatttccgctaaaatttcaagctccaaatgatcttgcactgaccgatcgatcgcgatcttggtgtacgtgtagcttaacaatttggcgagcatatggttcatagcgcttttcctgtcgatcatcgcgacgggggtgctggagctgcggtggagcggggtgagcatcgaggactggtggaggaacgagcagttctgggtgatcggcggcgtgtcggcgcacctgttcgccgtgttccagggcctcctcaaggtgctcggcggcgtggacaccaacttcacggtgacgtccaaggccgccgccgacgagaccgacgcgttcggcgagctctacctgttcaagtggacgacgctgctggtgccgccgacgacgctgatcatcatcaacatggtggggatcgtcgccggcgtgtcggacgccgtgaacaacgggtacgggtcgtggggcccgctgttcgggaagctcttcttctccttctgggtcatcctccacctctaccccttcctcaaggggctcatggggaggcagaaccggacgcccaccattgtcgtgctctggtccatcctcctcgcctccatcttctccctcgtctgggtcaggatcgaccccttcatccccaagcccaagggccccgtcctcaagccatgcggggtctcgtgctgagctgctgctgctacttctctgtgtctctgcattttgcaagagggatgaccggatggatgattcttgttgtatggagtattttgacttgttcatgtacaagtttttgtgagtgggataaaagtgttttgggggtaaaatttgtaagaactgaggtggagattatactcgaatttaagaacaattgtttttgaattttctttt</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0467800, RefSeq:Os10g0467800