Os02g0677300

From RiceWiki
Revision as of 02:26, 4 June 2014 by Fengdongmoqing (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Nine CBF/DREB1homologous genes in rice were obtained by BLAST search in the NCBI database, which share conserved amino acid sequences with DREB1 protein in Arabidopsis. Three CBFgenes organized in tandem, named OsCBF1, OsCBF2and OsCBF3, showed a transient induction in the process of cold acclimation, much stronger in indica rice 93-11 compared with japonica rice Nipponbare.The candidate downstream genes OsLIP5and OsLIP9were induced in 93-11 but notin Nipponbare. The differential expression of CBF regulon might be caused by polymorphisms within promoter sequences between these two rice varieties.One of the nine homologous CBF/DREB1 genes and the center of resistance to cold way.Gene expression profiling analysis shows that the CBF genes of rice can upstream the express of stress tolerance genes to enhance the cold tolerance of transgenic rice,like OsP5CS,OsLIP5,Os-LIP9,OsRAmy3D and so on.

Expression

Please input expression information here. CBF (C-repeat-binding factor) cold response pathway has proven to play important roles in cold acclimation[1]. CBF/DREB1 (dehydration- responsive element-binding protein) proteins belong to a subfamily of AP2/ERF (APETALA2/ethylene- responsive factor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element) motif and activates downstream genes [2]. The expression of CBF/DREB1genes is regulated by an upstream transcription factor ICE1 (inducer of CBFexpression 1) [3]. After activated by low temperature, the ICE1 protein binds specifically to the MYC (myelocytomatosis oncogene) recognition sequences present in CBF/DREB1promoters and stimulates the transcriptions of CBF/DREB1genes [4]. CBF cold response pathway is conserved not only intemperate plants like Arabidopsis, wheat and Brassica napus, but also in tropical plants like rice and tomato[5], [6], [7]. Several CBF/DREB1homologous genes identified from rice have proven to improve cold tolerance of transgenic Arabidopsis and rice[8], [9].Using the microarray analysis, several candidate target genes of CBF/DREB1 protein were identified in rice, such as OsP5CS, OsLIP5, OsLIP9,and OsRAmy3D[9].The induction of these target genes improves the cold tolerance of rice plants through mediating various physiological and biochemical processes.

CBF cold response pathway has proven to play critical roles in cold acclimation in many subspecies [5]. In order to know the molecular basis of rice cold acclimation, we examined the expression of CBF/DREB1genes in the process of cold acclimation at 10 °C. As shown in Fig. 4
Table : Time-course expression of rice genes and candidate downstream genes in the process of acclimation.
, the three CBF/DREB1genes (OsCBF1, OsCBF2and OsCBF3) exhibited similar expression profiles during cold acclimation in Nipponbare and 93-11. The transcriptions increased at 1 h and subsequently reachedtheir peaks at 2 h and then decreased. Interestingly, the gene induction was much stronger in 93-11 than in Nipponbare. The CBF proteins can bind to the CRT/DRE regulatory element and activate the expression of downstream target genes[8]. Therefore, we further analyzed the expression of several candidate down- stream genes. Cold-induced genes OsLIP5and OsLIP9showed no obvious changes in Nipponbare during cold acclimation. Differently, the expression of these two genes was induced after acclimation for 2 h and then decreased in 93-11. Another candidate target gene OsP5CS, encoding a central enzyme in the proline biosynthesis, exhibited induction both in Nipponbare and 93-11. However, the induction was stronger in 93-11 than in Nipponbare. Based on these results, we proposed that differential induction of CBF/DREB1genes during cold acclimation might result in differential expression of downstream genes and was responsible for significant EL decrease in 93-11 compared to that in Nipponbare.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will. CBF/DREB1 (dehydrationresponsiveelement-binding protein) proteins belong to a subfamily of AP2/ERF(APETALA2/ethyleneresponsivefactor) transcription factor and contain a highly conserved DNA-binding domain which interacts with CRT/DRE (C-repeat/drought-responsive element)motif and activates downstream genes.This genes share extensive homology, not only in the AP2/ERF region but also in the C-terminal regions and signatures bordering the AP2/ERF domain[1].we found that all the CBF/DREB1 homologous proteins in rice had a conserved valine in the V14 position and a conserved glutamic acid in V19 position, which play important roles in DNA-binding specificity.At the same time,V14 is a great important for the transcriptional activity of CBF protein.

Labs working on this gene

Please input related labs here.

References

1.Canella D, Gilmour S J, Kuhn L A, Thomashow M F. 2010. DNA binding by the ArabidopsisCBF1 transcription factor requires the PKKP/RAGRxKFxETRHP signature sequence. Biochim Biophys Acta, 1799: 454–462. 2.Wang Y, Hua J. 2009. A moderate decrease in temperature induces COR15aexpression through the CBF signaling cascade and enhances freezing tolerance. Plant J, 60: 340–349. 3.Chinnusamy V, Ohta M, Kanrar S, Lee B H, Hong X, Agarwal M, Zhu J K. 2003. ICE1: A regulator of cold-induced transcriptome and freezing tolerance in Arabidopsis. Genes Dev, 17: 1043–1054. 4.Miura K, Jin J B, Lee J, Yoo C Y, Stirm V, Miura T, Ashworth E N, Bressan R A, Yun D J, Hasegawa P M. 2007. SIZ1-mediated sumoylation of ICE1 controls CBF3/DREB1Aexpression and freezing tolerance in Arabidopsis. Plant Cell, 19: 1403–1414. 5.Jaglo K R, Kleff S, Amundsen K L, Zhang X, Haake V, Zhang J Z, Deits T, Thomashow M F. 2001. Components of the Arabidopsis=C-repeat/dehydration-responsive element binding factor cold-response pathway are conserved in Brassica napusand other plant species. Plant Physiol, 127: 910–917. 6.Zhang X, Fowler S G, Cheng H, Lou Y, Rhee S Y, Stockinger E J, Thomashow M F. 2004. Freezing-sensitive tomato has a functional CBF cold response pathway, but a CBF regulon that differs from that of freezing-tolerant Arabidopsis. Plant J, 39: 905–919. 7.Kume S, Kobayashi F, Ishibashi M, OhnoR, NakamuraC, Takumi S. 2005. Differential and coordinated expression of Cbfand Cor/Leagenes during long-term cold acclimation in two wheat cultivars showing distinct levels of freezing tolerance. GenesGenet Syst, 80: 185–197. 8.Dubouzet J G, Sakuma Y, Ito Y, Kasuga M, Dubouzet E G, Miura S, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2003. OsDREBgenes in rice, Oryza sativa L., encode transcription activators that function in drought-, high-salt- and cold-responsive gene expression. Plant J, 33: 751–763. 9.Ito Y, Katsura K, Maruyama K, Taji T, Kobayashi M, Seki M, Shinozaki K, Yamaguchi-Shinozaki K. 2006. Functional analysis of rice DREB1/CBF-type transcription factors involved in cold-responsive gene expression in transgenic rice. Plant Cell Physiol, 47: 141–153.

Structured Information

Gene Name

Os02g0677300

Description

Similar to CRT/DRE binding factor 1

Version

NM_001054262.1 GI:115447894 GeneID:4330306

Length

1272 bp

Definition

Oryza sativa Japonica Group Os02g0677300, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:28539796..28541067

Sequence Coding Region

28539841..28540515

Expression

GEO Profiles:Os02g0677300

Genome Context

<gbrowseImage1> name=NC_008395:28539796..28541067 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:28539796..28541067 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactga</cdnaseq>

Protein Sequence

<aaseq>MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGR TKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALALR GRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGA TNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPPPMAGDPAVGSGEDDNDGE VQLWSY</aaseq>

Gene Sequence

<dnaseqindica>46..720#agaattcaaaccggatcaacctcgctcgcttactcgtgtttaggcatggacgtttctgctgcgctcagcagcgactactcgtcggggacgccgtcgccggtggcggccgacgccgacgacggctcctccgcctacatgacggtgtcgtcggcgccgcccaagcggcgagcggggcggaccaagttcaaggagacgcggcaccccgtgttcaagggcgtgcgccggaggaaccccgggaggtgggtgtgcgaggtgcgcgagccgcacggcaagcagcggatatggctcgggacgttcgagacagcagagatggcggcgcgcgcgcacgacgtcgccgcgctcgcgctccgcggccgcgccgcctgcctcaacttcgccgactcgccgaggcgcctccgcgtcccgcccatcggcgcaagccacgacgacatacggagggcggcggctgaggcggccgaggcattccggccgccaccagatgagagcaatgcggccaccgaggtggcagccgccgcatcgggcgccactaattcgaacgccgaacagttcgcctcccacccgtactacgaggtcatggacgatgggctggacttggggatgcagggctatctcgacatggcgcaagggatgctcattgacccgcctccaatggccggtgatcctgccgtaggtagcggcgaagacgacaacgatggcgaggtccagctatggagctactgatcctgcgcgtttgaactcaacttggtttggcgcgaagagatcgcatgtacagcttaagggagtcgagtacaagtacctcaggtgtactccactcgttgcccctttcccttccctttcgtttttcttgagcttatctgcagggtaatgttatgtattgctgctcttctgatgaaatgtgatcggaagaagcggaaggccagatcgagcttatgggttctgaagacggtgaaggcttgtcgagtgttgtgagcatatattcagaaagtcaggcactgtgaaagtatgaatcagatcagccttgttacgaatgagagtgatcgaccttgttcagtgtttataattgaaccacttgtgtgtaataagcagcaaagccatgttgcttgcttgatctgactcttgggaatggtatatttctcaaagaatgcaggattgactactcagaatttgacattttgcagtgaaatgataggattgttaaattaacattggaggagaggcatgtgtatatatgttaagaaacattagtaatgatgagcctatgatacttcgatc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0677300, RefSeq:Os02g0677300

1.PAN, X.-W.; LI, Y.-c.; LI, X.-x.; LIU, W.-q.; MING, J.; LU, T.-t.; TAN, J.; SHENG, X.-n., Differential Regulatory Mechanisms of CBF Regulon Between Nipponbare (Japonica) and 93-11 (Indica) During Cold Acclimation. Rice Science 2013, 20 (3), 165-172.
  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3
  4. Cite error: Invalid <ref> tag; no text was provided for refs named ref4
  5. 5.0 5.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref5
  6. Cite error: Invalid <ref> tag; no text was provided for refs named ref6
  7. Cite error: Invalid <ref> tag; no text was provided for refs named ref7
  8. 8.0 8.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref8
  9. 9.0 9.1 Cite error: Invalid <ref> tag; no text was provided for refs named ref9