Os03g0766100
Please input one-sentence summary here.
CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I.
Contents
Annotated Information
Function
Sulfur-rich prolamin gene CysR10 locates in chromosome 3, and encodes Cysteine-Rich 10 kDa Prolamin. RP10 [1], CysR10 [2], and crP10 [3] represent the same gene. The rice prolamins consist of 60% Cys-rich prolamins and 40% Cys-poor prolamins, and the 10, 14 and 16 kDa prolamins are Cys-rich species, while the 13 kDa prolamin is a Cys-poor species [4]. The 10 kDa prolamins (CysR10) share minimal sequence homology with the other two classes and are characterized by their high content of methionine (20%) and cysteine (10%) residues [5]. In rice, there are two types of protein bodies (PBs), called PB-I in which prolamins are accumulated as intracisternal protein granules and PB-II. These prolamin species are asymmetrically distributed within PB-I and that CysR10 is essential for formation of the tightly compact, spherical shaped structure of PB-I [2].
Expression
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
- ↑ Pai-Hsiang Su; Su-May Yu; Ching-San Chen. Expression analyses of a rice 10 kDa sulfur-rich prolamin gene. Botanical Bulletin of Academia Sinica, 2004, 45(2): 101-109.
- ↑ 2.0 2.1 Ai Nagamine; Hiroaki Matsusaka; Tomokazu Ushijima; Yasushi Kawagoe; Masahiro Ogawa; Thomas W. Okita; Toshihiro Kumamaru. A Role for the Cysteine-Rich 10 kDa Prolamin in Protein Body I Formation in Rice Plant and Cell Physiology, 2011, 52(6): 1003-1016.
- ↑ Yayoi Onda; Ai Nagamine; Mutsumi Sakurai; Toshihiro Kumamaru; Masahiro Ogawa; Yasushi Kawagoe. Distinct Roles of Protein Disulfide Isomerase and P5 Sulfhydryl Oxidoreductases in Multiple Pathways for Oxidation of Structurally Diverse Storage Proteins in Rice The Plant Cell, 2011, 23(1): 210-223.
- ↑ Ogawa, M., Kumamaru, T., Satoh, H., Iwata, N., Omura, T., Kasai, Z. et al. (1987) Purification of protein body-I of rice seed and its polypeptide composition. Plant Cell Physiol.28: 1517–1527.
- ↑ Masumura, T., Shibata, D., Hibino, T., Kato, T., Kawabe, K., Takeba, G. et al. (1989) cDNA cloning of an mRNA encoding a sulfur-rich 10 kDa prolamin polypeptide in rice seeds. Plant Mol. Biol. 12:123–130.
Cite error: <ref> tag with name "ref6" defined in <references> is not used in prior text.
Cite error: <ref> tag with name "ref7" defined in <references> is not used in prior text.
Structured Information
| Gene Name |
Os03g0766100 |
|---|---|
| Description |
10 kDa prolamin precursor |
| Version |
NM_001057915.1 GI:115455558 GeneID:4334227 |
| Length |
574 bp |
| Definition |
Oryza sativa Japonica Group Os03g0766100, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 3:32580334..32580907 |
| Sequence Coding Region |
32580436..32580840 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008396:32580334..32580907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttga</cdnaseq> |
| Protein Sequence |
<aaseq>MAAYTSKIFALFALIALSASATTAITTMQYFPPTLAMGTMDPCR QYMMQTLGMGSSTAMFMSQPMALLQQQCCMQLQGMMPQCHCGTSCQMMQSMQQVICAG LGQQQMMKMAMQMPYMCNMAPVNFQLSSCGCC</aaseq> |
| Gene Sequence |
<dnaseqindica>68..472#atcatcctcaacaatattgtctacaccatctggaatcttgtttaacactagtattgtagaatcagcaatggcagcatacaccagcaagatctttgccctgtttgccttaattgctctttctgcaagtgccactactgcaatcaccactatgcagtatttcccaccaacattagccatgggcaccatggatccgtgtaggcagtacatgatgcaaacgttgggcatgggtagctccacagccatgttcatgtcgcagccaatggcgctcctgcagcagcaatgttgcatgcagctacaaggcatgatgcctcagtgccactgtggcaccagttgccagatgatgcagagcatgcaacaagttatttgtgctggactcgggcagcagcagatgatgaagatggcgatgcagatgccatacatgtgcaacatggcccctgtcaacttccaactctcttcctgtggttgttgttgatcaaacgttggttacatgtactctagtaataaggtgttgcatactatcgtgtgcaaacactagaaataagaaccattgaataaaatatcaatcattttcaga</dnaseqindica> |
| External Link(s) |
