Os02g0747900
Please input one-sentence summary here.
Contents
Annotated Information
Function
Os02g0747900 (LOC_Os02g51320 in MSU Rice Genome Annotation Project) is an atypical bHLH of unknown function and was named Os170 and belonging to subfamily 16 of bHLH proteins in a phylogenetic study (Carretero-Paulet et al. 2010). Phylogenetic analysis of amino acid sequences of members of subfamily 16 revealed that the closest homolog of Os02g0747900 is a rice bHLH protein BRASSIONOSTEROID UPREGULATED 1 (BU1, Tanaka et al. 2009) with 90.8% amino acid identity . Many members of subfamily 16, such as rice Ili1 and BU1, Arabidopsis PRE1 and ATBS1 and tomato Style2.1, were reported to control cell elongation and expansion in specific organs probably through heterodimerization with other bHLH proteins (Wang et al. 2009, Zhang et al. 2009). In addition, PGL1 (Os03g0171300) as a positive regulator of the grain length and weight of rice (Heang and Sassa 2012). However, the function of Os02g0747900 has not been elucidated yet. Os02g0747900 as PGL2 (POSITIVE REGULATOR OF GRAIN LENGTH 2) based on functional analyses . PGL2 has 52.9% and 94.3% whole amino acid identity and similarity, respectively, to PGL1 and 48.1% and 98.1% identity and similarity, respectively, in the HLH domain alone.
Expression
Expression analysis of PGL2 by RT-PCR showed that the gene is expressed in different organs including reproductive organs such as the young panicle, pistil and lemma/palea.d high level of expression of PGL1 in lemma/palea by using the chitinase promoter(Heang and Sassa 2012). Eight independent T0 transgenic lines,PGL2 : OX, were produced. The grain sizes of the T0 lines are larger than those of wild types. Sciencetists previously showed that overexpression of PGL1, a homolog of PGL2, in the lemma/palea increased grain length and weight in rice (Heang and Sassa 2012).Therefore,The correlation between the expression levels of PGL2 in lemma/palea and the grain size of transgenic plants. As expected, up-regulation of PGL2 expression in lemma/palea was associated with the grain length and weight
Evolution
Please input evolution information here.
You can also add sub-section(s) at will.
Labs working on this gene
Please input related labs here.
References
Please input cited references here.
Structured Information
| Gene Name |
Os02g0747900 |
|---|---|
| Description |
Helix-loop-helix DNA-binding domain containing protein |
| Version |
NM_001054653.2 GI:297599921 GeneID:4330725 |
| Length |
1269 bp |
| Definition |
Oryza sativa Japonica Group Os02g0747900, complete gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Chromosome 2:32310829..32312097 |
| Sequence Coding Region |
32311348..32311509 |
| Expression | |
| Genome Context |
<gbrowseImage1> name=NC_008395:32310829..32312097 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1> |
| Gene Structure |
<gbrowseImage2> name=NC_008395:32310829..32312097 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2> |
| Coding Sequence |
<cdnaseq>atgcaggcgtcgacgacgaagctgctgaaggagacgtgcaactacatcaagagccttcaccgggaggtggatgacctcagcgaccggctgtccgacctcatggccaccatggatcacaacagccccggcgcggagatcatccgcagcatcctccgctcctga</cdnaseq> |
| Protein Sequence |
<aaseq>MQASTTKLLKETCNYIKSLHREVDDLSDRLSDLMATMDHNSPGA EIIRSILRS</aaseq> |
| Gene Sequence |
<dnaseqindica>589..750#acacacttctcccatccagctagcttttgcagatcgagcgaaccttcaacacaaaccggccagcttgttcctctcctctctctctctctctctctctctctcggtcgcagccagctaacttcgagtgtgaagaacactcacgctagctagctttctcaaggccacatacgctagctccgcctccacgcgcggcgtacgtctagtttgattgaggctgaagagagtgcgtgtttggtagaagaggctagctgttgacgatgtcgagcagaaggtcgtcgcgtggctccatctcggaggaggaaatcaacgagctcatctccaagctccagtcgctgctccccaactcacgccgacgcggctccagccaggtagctaaccacattcttgcatacgccaactgcttgtgtactgctagtgtgctgccactttggtagtagctataggtttgctttcggtgaacacagaagtggctactactagaacaatccacacactactatagtcgtgtgtgtgggtggtggtttggggttaagcccgtgagcgattcggtgtgtgttttgtctgcacgagacgagtaatgtggcgttaatgcaggcgtcgacgacgaagctgctgaaggagacgtgcaactacatcaagagccttcaccgggaggtggatgacctcagcgaccggctgtccgacctcatggccaccatggatcacaacagccccggcgcggagatcatccgcagcatcctccgctcctgatcggcaagcagcagcagcaagcggcaccggccggccggccggcctatgtcgacgacgagataggccgggccggccgggcaacgcccgcggcgccaattaatcaagcgtacgtcctgccggcgccattctccggccaccagagagcatttagctagggtatatatatctacatatataaaatatttatgtcgtatgtccctccccaaatgtacgagccacgcttacacgcgcgtgtatcgatctctcgatctctctctctaagctccactcgaagtagggcattagcactaggggcctaagcagaggcttatcctcgctttagctcatattttcatcgcttgatgtgtcctctctgaacccccacatcttgtcttgtttggtttttccctctcccttccaatctatgtaaatttagctggtgtggtttggatcgagttgtgtcctctacagacaaccgaccgaccactactacctagaggaaattaatatcatcatgggtgtactgctccagctttaact</dnaseqindica> |
| External Link(s) |