Os07g0585700

From RiceWiki
Revision as of 10:42, 5 June 2014 by Zongyuan (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here.   Seed dormancy 4 (Sdr4), encodes a novel protein with an amino acid sequence that has no similarity to proteins with known functions, it contributes substantially to differences in seed dormancy between japonica (Nipponbare) and indica (Kasalath) cultivars. Sdr4 expression is positively regulated by OsVP1, a global regulator of seed maturation, and in turn positively regulates potential regulators of seed dormancy and represses the expression of postgerminative genes, suggesting that Sdr4 acts as an intermediate regulator of dormancy in the seed maturation program. Japonica cultivars have only the Nipponbare allele (Sdr4-n), which endows reduced dormancy, whereas both the Kasalath allele (Srd4-k) and Sdr4-n are widely distributed in the indica group, indicating prevalent introgression. Srd4-k also is found in the wild ancestor Oryza rufipogon, whereas Sdr4-n appears to have been produced through at least two mutation events from the closest O. rufipogon allele among the accessions examined. Furthermore, haplotype analysis of the Sdr4 region has revealed that Sdr4 acts as an important determinant of seed dormancy in rice cultivars and might have been involved in rice domestication.   The seeds of two independent sdr4 mutant lines, M25 and M100, contained embryos larger than those of the wild type (Fig. 4 C and D) and were completely nondormant (nearly 100% germination at 4WAH; Fig. 4E). The loss of dormancy was associated with severely reduced ABA sensitivity. Germination of sdr4 seeds at 6 WAH was not inhibited by ABA at 100 μM, whereas that of Nipponbare seeds was completely inhibited (Fig. 4F); however, no significant differences in the ABA content of seeds sampled at 6 WAH were seen (83 ng/g fresh weight for Nipponbare, 87 ng/g for NIL(Sdr4), 83 ng/g for M25, and 78 ng/g for M100).

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os07g0585700

Description

Conserved hypothetical protein

Version

NM_001188348.1 GI:297725826 GeneID:9269794

Length

1032 bp

Definition

Oryza sativa Japonica Group Os07g0585700, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 7

Location

Chromosome 7:24456768..24457799

Sequence Coding Region

24456768..24457799

Expression

GEO Profiles:Os07g0585700

Genome Context

<gbrowseImage1> name=NC_008400:24456768..24457799 source=RiceChromosome07 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008400:24456768..24457799 source=RiceChromosome07 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggccatggtgcagccggtggacatggccgtgaaggccaacgagatcatggcgaggttcaggcccatcgcgcccaagcccgtgctgccggcggcggcggcgggggtgacgggtggtggtgacggtgctgcggcggtggcggcgacgaaccgcgtgctctgccagctgcagagcaggccgtgccgggcgcggaagcgggggcggcccagcgtagtgccgccggtgtccccgccggcgggggccaagaggaagagggcgccggcgtacccggtccccgtggcgccgctccggtgcgcggcggtggccacggcgacgagggcgcgcgtgtcggtggtggtcgtcccggccccggagagtgcgggcggggttagtgcgctggcgccggtgtcgccgagtgccggggactcgacgaggctctcgccgacggtggtggaggtggaggacgaggacgaggagaggggcgtggtgctcgtggagcgcgacctgctgcggaagctgctggagccgcggaagctgctggagccgcgcgcggtgcgccccgtgggctccaccatccacgtcgagtcagtccacatcgacgtcggccgcaccaccgccgccgccgccgcagccgccccgaagacggcggaggaggtggaggcggagctggagtcggactccctcccggcggtggtctcggactccagcaaccgcgtccggctggtgaacgacgcgtacaagcgaatggtggggcagcccgagtgcccgtggctcgacgccgtggccaccgccgcgtccaggaggatcagcggcgaggtggcgctggtagtgtccgagccggcggcggcggcggcggcgctgccggagacatgcaaggggttctcgtgctcggccaagatcgcgtgggagcgcgacggcaagtggtcatccgtccatgcaccgtgcgacgtcacccggctgcagtgcgagtcgagggactacgtcttcgcctggaggttccgcgccgccggcgacgaatgcaacacccaccgccgcgccgccggcgacgcgtga</cdnaseq>

Protein Sequence

<aaseq>MAMVQPVDMAVKANEIMARFRPIAPKPVLPAAAAGVTGGGDGAA AVAATNRVLCQLQSRPCRARKRGRPSVVPPVSPPAGAKRKRAPAYPVPVAPLRCAAVA TATRARVSVVVVPAPESAGGVSALAPVSPSAGDSTRLSPTVVEVEDEDEERGVVLVER DLLRKLLEPRKLLEPRAVRPVGSTIHVESVHIDVGRTTAAAAAAAPKTAEEVEAELES DSLPAVVSDSSNRVRLVNDAYKRMVGQPECPWLDAVATAASRRISGEVALVVSEPAAA AAALPETCKGFSCSAKIAWERDGKWSSVHAPCDVTRLQCESRDYVFAWRFRAAGDECN THRRAAGDA</aaseq>

Gene Sequence

<dnaseqindica>1..1032#atggccatggtgcagccggtggacatggccgtgaaggccaacgagatcatggcgaggttcaggcccatcgcgcccaagcccgtgctgccggcggcggcggcgggggtgacgggtggtggtgacggtgctgcggcggtggcggcgacgaaccgcgtgctctgccagctgcagagcaggccgtgccgggcgcggaagcgggggcggcccagcgtagtgccgccggtgtccccgccggcgggggccaagaggaagagggcgccggcgtacccggtccccgtggcgccgctccggtgcgcggcggtggccacggcgacgagggcgcgcgtgtcggtggtggtcgtcccggccccggagagtgcgggcggggttagtgcgctggcgccggtgtcgccgagtgccggggactcgacgaggctctcgccgacggtggtggaggtggaggacgaggacgaggagaggggcgtggtgctcgtggagcgcgacctgctgcggaagctgctggagccgcggaagctgctggagccgcgcgcggtgcgccccgtgggctccaccatccacgtcgagtcagtccacatcgacgtcggccgcaccaccgccgccgccgccgcagccgccccgaagacggcggaggaggtggaggcggagctggagtcggactccctcccggcggtggtctcggactccagcaaccgcgtccggctggtgaacgacgcgtacaagcgaatggtggggcagcccgagtgcccgtggctcgacgccgtggccaccgccgcgtccaggaggatcagcggcgaggtggcgctggtagtgtccgagccggcggcggcggcggcggcgctgccggagacatgcaaggggttctcgtgctcggccaagatcgcgtgggagcgcgacggcaagtggtcatccgtccatgcaccgtgcgacgtcacccggctgcagtgcgagtcgagggactacgtcttcgcctggaggttccgcgccgccggcgacgaatgcaacacccaccgccgcgccgccggcgacgcgtga</dnaseqindica>

External Link(s)

NCBI Gene:Os07g0585700, RefSeq:Os07g0585700