Atp6

From RiceWiki
Revision as of 12:05, 5 June 2014 by Xizanghanzi (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

ATP synthase consists of two distinct parts, a hydrophilic F1 part which contains the nucleotide-binding site and catalyzes ATP hydrolysis, and a hydrophobic F0 part which channels protons through the membrane. atp6 is a unit of F0 and coded by atp6 gene. Besides, the atp6 gene is encoded in mitochondrial genome, and has about 1000 base pairs. Most researches show atp6 gene is related to male sterility--Plants that fail to produce fertile pollen grains. The CMS phenotype has been related to a homologous recombination hotspot domain in the atp6 gene, with a conserved sequence of 7 base pair 5’-TTCCCTC-3’ which can induce the formation of chimeric gene in mitochondrial DNA[1]. In rice, the [BO] type of CMS has been shown to be associated with an additional chimeric gene urfrmc which consists of the 5’ flanking noncoding region of atp6. Akagi et al. report that recombination events around some mitochondrial genes specially atp6, are involved in causing male sterility in Chinsurah BoroII type of CMS in rice[2]. What’s more, the function of atp6 gene is probably related to several abiotic stresses from salts, drought, and cold. Zhang et al. find that over-expression of atp6 gene in rice increases the resistance to carbonate stress, and over-expression of atp6 gene in transgenic yeast and Arabidopsis plants increased the resistance to salts, drought, oxidative and cold stresses[3].

Expression

Please input expression information here.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

atp6

Description

ATP synthase F0 subunit 6

Version

GeneID:6450195

Length

1005 bp

Definition

Oryza sativa Japonica Group atp6, Mitochondrion gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Mitochondrion

Location

Mitochondrion:225271..226275

Sequence Coding Region

225271..226275

Genome Context

<gbrowseImage1> name=NC_011033:225271..226275 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage1>

Gene Structure
(RNA Editing)

<gbrowseImage2> name=NC_011033:225271..226275 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2>

Protein Sequence

<aaseq>MNFDYNHVVIMGLNQRDSIWKLLNDYNVNSLKRRRQAEIDAFFEPFERAQRIRFNNWQNGIELLDGAEWRNGDIVIPGGGGPVISSPLDQFFIDPLFGLDMGNFYLSFTNESLFMAVTVVLVLSLFGVVTKKGGGKLVPNAWQSLVELIYDFVLNLVNEQIGGNVKQKFFPCILVTFTFSLFCNLQGMIPFSFTVTSHFLITLALSFSIFIGITIVGFQRHGLHFFSFLLPAGVPLPLAPFLVLLELISYCFRALSLGIRLFANMMAGHSLVKILSGFAWTMLFLNNIFYFIGDLGPLFIVLALTGLELGVAILQAYVFTILICIYLNDAINLH</aaseq>

Gene Sequence

<dnaseqindica>1..1005#atgaatttcgatcacaatcatgtggtaataatgggtttgaatcagagagactcgatctggaaactcctcaatgattataacgtgaactcgttgaagagaaggagacaagcagaaatagacgctttttttgaaccatttgagagggcgcagcgtatccgtttcaataactggcagaacggaatagagttgttagatggggctgaatggaggaacggcgatatagttatccctggaggcggcggaccagtaatttcaagccccttggatcaatttttcattgatccattatttggtcttgatatgggtaacttttatttatcattcacaaatgaatccttgtctatggcggtaactgtcgttttggtgccatctttatttggagttgttacgaaaaagggcgggggaaagtcagtgccaaatgcatggcaatccttggtagagcttatttatgatttcgtgctgaacctggtaaacgaacaaataggtggaaatgttaaacaaaagtttttccctcgcatctcggtcacttttactttttcgttatttcgtaatccccagggtatgataccctttagcttcacagtgacaagtcattttctcattactttggctctttcattttccatttttataggcattacgatcgttggatttcaaagacatgggcttcatttttttagcttcttattaccagcgggagtcccactgccattagcaccttttttagtactccttgagctaatctctcattgttttcgtgcattaagctcaggaatacgtttatttgctaatatgatggccggtcatagttcagtaaagattttaagtgggttcgcttggactatgctatttctgaataatattttctatttcataggagatcttggtcccttatttatagttctagcattaaccggtctggaattaggtgtagctatattacaagctcatgtttctacgatctcaatttgtatttacttgaatgatgctataaatctccatcaa</dnaseqindica>

External Link(s)

NCBI Gene:atp6

  1. Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3