Os09g0396900

From RiceWiki
Revision as of 05:13, 6 June 2014 by Littlescrew (talk | contribs) (Subcellular localization)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

OsVIT1 and OsVIT2 may function primarily in flag leaves to mediate vacuolar sequestration of Fe and Zn, due to highly expression levels of OsVIT1 and OsVIT2 in flag leaves rather than embryos. And they might also mediate allocation of Fe/Zn between flag leaves and the grains[1]. Knockdown of the vacuolar Fe transporter gene OsVIT1 or OsVIT2 may be useful to further increase the Fe concentration of seeds [2].

Expression

OsVIT2 locates in chromosome 9, and encodes putative protein as the vacuolar iron transporter with 247 amino acids which shares 79.8% amino acid similarity with the VIT in Arabidopsis. There are five conserved transmembrane domains in OsVIT2 by further analyses. This gene expresses in flag leaf blades with a significantly high level, but it can also be detected in various tissues/organs including embryos at low levels. Different from OsVIT2, OsVIT1 expresses mainly in flag leaf blades, but also occurs ubiquitously in various tissues/organs including embryos with relatively low levels [1]. OsVIT2 was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, but OsVIT1 was not highly induced. Fe starvation caused downregulated OsVIT2 expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots. These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels [1].

Subcellular localization

Figure 1.Subcellular localization of OsVIT1 and OsVIT2[1].(a–c) Bright-field images of Arabidopsis protoplasts expressing enhanced green fluorescent protein (EGFP) (a), OsVIT1: EGFP (b) and OsVIT2: EGFP(c).(d–f) Fluorescence images of Arabidopsis protoplasts expressing EGFP (d), OsVIT1: EGFP (e) and OsVIT2: EGFP(f).(g–i) Merged fluorescence images of EGFP (g), OsVIT1: EGFP (h) and OsVIT2: EGFP (i). Bars = 10μm.

OsVIT1 and OsVIT2 were localized to vacuolar membrane[1] when they combined with enhanced green fluorescent protein and expressed(Figure 1).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

Please input cited references here.

Structured Information

Gene Name

Os09g0396900

Description

Protein of unknown function DUF125, transmembrane family protein

Version

NM_001069636.1 GI:115479014 GeneID:4346978

Length

1732 bp

Definition

Oryza sativa Japonica Group Os09g0396900, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 9

Location

Chromosome 9:14485581..14487312

Sequence Coding Region

14485745..14485831,14486458..14486570,14486742..14487042

Expression

GEO Profiles:Os09g0396900

Genome Context

<gbrowseImage1> name=NC_008402:14485581..14487312 source=RiceChromosome09 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008402:14485581..14487312 source=RiceChromosome09 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggtgaaggagttcgtgcaggacgaggagaagcagcggctgctgctggacgagcacaccgagaagcacttcaccgccggcgaggtggccgcggagatcgcggacatactgtcgcagtatgggctgggcccagaggagtatgggcccgttgttaactccctccgcagcaaccccaaggcctggctcgaattcatgatgaagtttgagttgggactggagaagccggaaccaaggagggcgctgatgagcgcgggaacgatcgcgctggcttatgtggtgggtgggctggtgccactcctaccctacatgtttgtgccgacggccgaccgagccatggccacctcggtcgtcgtcacgctcgccgcacttctcttcttcggctatgtcaagggccggtttactggcaaccggcccttcatcagcgccttccagaccgctgttatcggcgctctcgcctccgccgccgccttcggcatggccaaggccgtgcagtccatctaa</cdnaseq>

Protein Sequence

<aaseq>MVKEFVQDEEKQRLLLDEHTEKHFTAGEVAAEIADILSQYGLGP EEYGPVVNSLRSNPKAWLEFMMKFELGLEKPEPRRALMSAGTIALAYVVGGLVPLLPY MFVPTADRAMATSVVVTLAALLFFGYVKGRFTGNRPFISAFQTAVIGALASAAAFGMA KAVQSI</aaseq>

Gene Sequence

<dnaseqindica>165..251#878..990#1162..1462#gctcacacatcgatcacagaaagctaagctaaagtgctaaactaagcacgagaaaatctaatcaaccaagcttagattagatcattagctatatatagctaggcgatttaatcatccacgagctagcttattagctaagcagtagcagcagcagaagatcgaagatggtgaaggagttcgtgcaggacgaggagaagcagcggctgctgctggacgagcacaccgagaagcacttcaccgccggcgaggtggtccgcgacatcatcatcggcgtctccgacggcctcaccgtgccgttcgccctcgccgccggcctgtccggcgccaacgccccctccgccctcgtcctcaccgccggcctcgccgaggtcgccgccggcgccatctccatgggcctcggagggtaagcccaaaaccaaaaataaataaaaataaaacaaaataaaactttcctcctcttcttcttcctctgcaaatctctttctgttttttctttgatttctcaactattttgcttggcaaaatggcaagcatatgaatgcatgcgttttcacagccaaattaattaattaattacccttttttaccatgttttttcgctgcatttttctctcttggaattaaagttaattttgattgttattggattattttgattttaattataggtatctggcggcgaagagcgacgccgaccactaccaccgcgagctgcagagggagcaggaggagatcgacaccgtgccggacacaggtaattaattaagtcggtaacagtaattaatttctctcggagtttttttttactacatctgagtttattattaccacggtggtggttcgacggctgagattggtttggccccacttggcagaggccgcggagatcgcggacatactgtcgcagtatgggctgggcccagaggagtatgggcccgttgttaactccctccgcagcaaccccaaggcctggctcgaattcatgatgaagtaaggggaaaaaactaattaaatcgaattaaatttaaattaacttcattattatggaatttcatatttcttatgacaatagaaatgatttacatctcatgatcagtgtgggtgtcgtgtgttaaatacttggagaaatatataataacttatcggggacacatattataggtttgagttgggactggagaagccggaaccaaggagggcgctgatgagcgcgggaacgatcgcgctggcttatgtggtgggtgggctggtgccactcctaccctacatgtttgtgccgacggccgaccgagccatggccacctcggtcgtcgtcacgctcgccgcacttctcttcttcggctatgtcaagggccggtttactggcaaccggcccttcatcagcgccttccagaccgctgttatcggcgctctcgcctccgccgccgccttcggcatggccaaggccgtgcagtccatctaagtactgtagccggagctccggctgcaggcatccaagtaaatgtaattaatttagcagatccaataagtattgcagaaatgtatgtataagtatttatgtacgtttgctgcgtgcttgtagtgtattagatgttctggaggtgtatccgtagttagccctaagtgtaccatgtacacgagtgtaatcactcattttatatcgtcttctattttggctcccttttttatattcggttgggattaattaataatgtattgtcgatttgtaagc</dnaseqindica>

External Link(s)

NCBI Gene:Os09g0396900, RefSeq:Os09g0396900

  1. 1.0 1.1 1.2 1.3 Cite error: Invalid <ref> tag; no text was provided for refs named ref1
  2. Cite error: Invalid <ref> tag; no text was provided for refs named ref2