Os02g0148100

From RiceWiki
Revision as of 08:39, 6 June 2014 by Jin Xiaoyang (talk | contribs) (Evolution)
Jump to: navigation, search

OsMAPK33 (Os02g0148100) is a Mitogen-activated protein kinases (MAPK) cDNA clone in rice, which is mainly induced by drought stress

Annotated Information

Function

Under dehydration conditions, the suppressed lines showed lower osmotic potential compared with that of wild-type plants, suggesting a role ofOsMAPK33 in osmotic homeostasis. Nonetheless, the suppressed lines did not display any significant difference in drought tolerance compared with their wild-type plants. With increased salinity, there was still no difference in salt tolerance between OsMAPK33-suppressed lines and their wild-type plants. However, the overexpressing lines showed greater reduction in biomass accumulation and higher sodium uptake into cells, resulting in a lower K+/Na+ ratio inside the cell than that in the wild-type plants andOsMAPK33-suppressed lines. These results suggest that OsMAPK33could play a negative role in salt tolerance through unfavourable ion homeostasis. Gene expression profiling ofOsMAPK33transgenic lines through rice DNA chip analysis showed that OsMAPK33altered expression of genes involved in ion transport.[1]

Expression

OsMAPK33 is found to exhibit organ-specific expression with relatively higher expression in leaves as compared with roots or stems, and to exist as a single copy in the rice genome.[1]

Evolution

OsMAPK33 showed approximately 47–93% identity at the amino acid level with other plant MAPKs.[1] OsMAPK33was found to be the most closely related to OsMAP2 (92.7%) as previously reported (Wen et al. 2002). It also showed 44.1–92.7% identity at the amino acid level with previously reported plant MAPKs. TheOsMAPK33cDNA was 1549 bp long and encoded a polypeptide of 370 amino acids with a predicted molecular mass of 42.5 kDa. This cDNA had the same deduced amino acid sequence as OsMAP3 (AF216317) (Wen et al. 2002) and OsMAPK2 (AF241166). The OsMAPK33 cDNA was recently annotated as‘OsMPK14’by The Institute for Genomic Research (TIGR) rice MAPK community. Phylogenetic analysis indicated thatOsMAPK33 belongs to C group (C2) of MAPK proteins, along with OsMAPK4, Osmsrmk3 and OsMAP2. OsMAPK33 Phylogenetic.png

Labs working on this gene

1. Department of Agricultural Biotechnology, National Academy of Agricultural Science, Rural Development Administration, Suwon 441–857, Republic of Korea

2. Department of Biomedical Science, Sun Moon University, Asan 336–708, Republic of Korea

3. Soybean Genomics and Improvement Lab, USDA-ARS, Beltsville, MD 20705, USA

4. Department of Biological Sciences, Seoul National University, Seoul 151–742, Republic of Korea

References

  1. 1.0 1.1 1.2 Lee S-K, Kim B-G, Kwon T-R, Jeong M-J, Park S-R, Lee J-W, Byun M-O, Kwon H-B, Matthews BF, Hong C-B and Park S-C 2011 Overexpression of the mitogen-activated protein kinase geneOsMAPK33enhances sensitivity to salt stress in rice (Oryza sativaL.).J. Biosci.36 139–151

Structured Information

Gene Name

Os02g0148100

Description

MAP kinase MAPK2 (MAP kinase 3)

Version

NM_001052424.1 GI:115444218 GeneID:4328297

Length

3305 bp

Definition

Oryza sativa Japonica Group Os02g0148100, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:2643054..2646358

Sequence Coding Region

2643310..2643999,2645043..2645465

Expression

GEO Profiles:Os02g0148100

Genome Context

<gbrowseImage1> name=NC_008395:2643054..2646358 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:2643054..2646358 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgatcatggtggatcctccaaatgggatgggtaaccaagggaagtattactactcgatgtggcaaactttgtttgagatagacactaagtatgtgccaatcaagcccatcgggcgaggagcttatgggattgtttgttcatccataaatcgtgagaccaacgagaaagtagcaataaagaagatacacaatgtttttgacaaccgtgttgatgcactaaggactttgcgggagctgaaacttctccggcatctccgccatgagaatgttattgctttgaaggatataatgatgccagtacacaggaggagttttaaagatgtgtacttagtttatgaactcatggatactgacctgcatcagataatcaagtcacctcagggtctttccaatgatcactgccaatattttctttttcagttgcttcgaggactgaaatatctccattcagcagagatactccacagagacctgaaacctggaaatctactggttaatgcaaactgtgatctcaagatatgtgattttggtcttgcacgcacaaacagtagtaaaggtcagtttatgactgagtatgttgtcacccgctggtatagagctcctgagttgctcctttgctgtgacaactatggcacttccattgatgtttggtctgttggttgcatcttcgctgagctacttggtcggaaacctattttcccaggaactgagtgcctaaatcagctcaagctcattgtcaatgttcttggcaccatgagcgagtctgacttggagttcattgacaacccaaaagctcgcagatatatcaaatccctcccctacactcccggtgtgcccctcgcgagtatgtatccgcatgcacaccctcttgccattgatcttttacagaagatgctcatatttgatcctaccaaaagaatcagtgtcaccgaggctcttgagcacccttacatgtcccctctgtatgatccaagtgcaaatcctcccgcgcaagtgcctatcgatctggacatagacgagaacatcagtgcagatatgatcagggaaatgatgtggcacgagatgctccactaccaccctgaagttgttgcagcaatgagtgcccgatga</cdnaseq>

Protein Sequence

<aaseq>MAIMVDPPNGMGNQGKYYYSMWQTLFEIDTKYVPIKPIGRGAYG IVCSSINRETNEKVAIKKIHNVFDNRVDALRTLRELKLLRHLRHENVIALKDIMMPVH RRSFKDVYLVYELMDTDLHQIIKSPQGLSNDHCQYFLFQLLRGLKYLHSAEILHRDLK PGNLLVNANCDLKICDFGLARTNSSKGQFMTEYVVTRWYRAPELLLCCDNYGTSIDVW SVGCIFAELLGRKPIFPGTECLNQLKLIVNVLGTMSESDLEFIDNPKARRYIKSLPYT PGVPLASMYPHAHPLAIDLLQKMLIFDPTKRISVTEALEHPYMSPLYDPSANPPAQVP IDLDIDENISADMIREMMWHEMLHYHPEVVAAMSAR</aaseq>

Gene Sequence

<dnaseqindica>2360..3049#894..1316#atccacacctcacgggaagctgtcccttctcctcttctcctcctcggctgcggccacggcgacgacgacgacgacgaattcgagcgaggcgatcggcgatggaggcggtggcgatctgatccgctcttcccgtctcggcctcgcgctcctctccctccctcgcggtgtctcggggtgaggggaatcttttgtttttgttttttttgaccgtactgttctggctgggtgtttcttggtcgtggtccaagatcggcgggtggtttgtttgtccgggctccatggatcgatctctctctgttgatctgtgtagctggagaagctcagctccgtgggaggattacgcgcgcgtgattggttgggctgtgtgtaaatttggttgccggccatttttgtgctccggtggtgaatttgggtggtgaggctgtctgcacaatccgtggcgatgagctgggaaatgtgatgggggtgtgctcgtatcgggatgatggtgggttgtttggttgacccggatgagtgatgatgattcacaatcttgcatccatgaaccgtgggatgggtgtccatgtctttctccgggattgggaattggtaccaccaccatggcggttctaaaggcgggaggagataaatgcaggcggcaatgcatgcttggtgatggagcatctgtatgagtgtgcggggatcgatgctccatgttcattcagaaccatagccgagcaactgaaagctcatcttgaagactgggactgcgtttaatttatagctcatctttgattacaaagttgtttgatcttctgcattcatagatagtttggcagttgtgtaagctcaaaaagccgttgttatttcctaaggtagtactaacttattttcttttgtttccttagtaggaaatggcgatcatggtggatcctccaaatgggatgggtaaccaagggaagtattactactcgatgtggcaaactttgtttgagatagacactaagtatgtgccaatcaagcccatcgggcgaggagcttatgggattgtttgttcatccataaatcgtgagaccaacgagaaagtagcaataaagaagatacacaatgtttttgacaaccgtgttgatgcactaaggactttgcgggagctgaaacttctccggcatctccgccatgagaatgttattgctttgaaggatataatgatgccagtacacaggaggagttttaaagatgtgtacttagtttatgaactcatggatactgacctgcatcagataatcaagtcacctcagggtctttccaatgatcactgccaatattttctttttcaggtaatacctggacctctcttttctattctattctacatttacttactcaagagtaattgtgtgtttttaatggcccttgatgattgcttagaatttgtgacagtgcatcttatatcggcaagcctcatccagtcttataagatggttcattcccaaatgcacgaggcacaatcttaacttgaatggttcttctgtcagttaaaacttcaaagtcaaactgattttttaaacatgtaaaattgtgaatgttttgcttcagcaatgatttgtgagcatgtcaatgacaatacttttttgagtaatgtattcctaatttgaaataaccaatgtaacttgtagtatcattcagtttgattccagttgatttgatgtttttgcattagtagtatttgaaaaaaactgaaaaaatggcctactatatttattccaacccagattccaacagtttagactgataataaatagatggaaggcaaaactatatccctgtagtctgcagctttgagacaaactaaactacacactttgtgcattaagtattgccatcatgattcctctttttatacattttattttaatttgtagagttgaacatttattttcatgtgtcacaggcacaacatccatgcattcccttgttgcctcatcaagtacataaaaaagcagctattctaatgtccgttcaacctaaaactggaactggaaccatctagccctttttagatttccatctattctaacttattttattaatttcgttaaaccacatttccattaagaatttcatatacagttcataatctaaaacctagatcttctttcaaatagttctgcatagaggcttctgcatgaaaccacacaagtagaccctcttgtttacaagacataaatatttttctgatgaattgtctgttcatcctacccttcagattcatttattctgttgtcttgagttcattttggattgtctaccatgtatttcttattttttgcaatccgtattttccagatgatttaagagaatgttgttttcttgattgtagttgcttcgaggactgaaatatctccattcagcagagatactccacagagacctgaaacctggaaatctactggttaatgcaaactgtgatctcaagatatgtgattttggtcttgcacgcacaaacagtagtaaaggtcagtttatgactgagtatgttgtcacccgctggtatagagctcctgagttgctcctttgctgtgacaactatggcacttccattgatgtttggtctgttggttgcatcttcgctgagctacttggtcggaaacctattttcccaggaactgagtgcctaaatcagctcaagctcattgtcaatgttcttggcaccatgagcgagtctgacttggagttcattgacaacccaaaagctcgcagatatatcaaatccctcccctacactcccggtgtgcccctcgcgagtatgtatccgcatgcacaccctcttgccattgatcttttacagaagatgctcatatttgatcctaccaaaagaatcagtgtcaccgaggctcttgagcacccttacatgtcccctctgtatgatccaagtgcaaatcctcccgcgcaagtgcctatcgatctggacatagacgagaacatcagtgcagatatgatcagggaaatgatgtggcacgagatgctccactaccaccctgaagttgttgcagcaatgagtgcccgatgatcttcaactgtccccaggaactttgcaggctcacttttttttcttcttctaaaagcctacggcgattatcgcacctattaagtaaccaagacgtgcaagacttatttcatgtatatatgagcgaaataagaacgttgttgtatccatatagttcatgttatggaccattacttggtgtatgcatttcacatttccactggacagttatgttgttgtactagttcatgatgagaagtgctattaaagtgaattcagt</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0148100, RefSeq:Os02g0148100