Os01g0112400

From RiceWiki
Revision as of 09:04, 6 June 2014 by Andrew123 (talk | contribs) (Laboratory)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Rice at reproductive stage is more sensitive to environmental changes. Os01g0112400 plays a role in response to heat stress.

Function

In the rice genome, transporter family genes are grouped into 4 distinct types: ATP-dependent transporters, secondary transporters, ion channels, and unclassified transporters. As a gene related to sugar, peptide, amino acid and other metabolites transport,most genes are heat-induced or identified as HR genes. While OsTIP4;1(Os01g0112400) and OsTIP4;1(Os05g0231700) were continuously late elevated during heating in rice panicle . the reason is still unknown.


Laboratory

Key Laboratory for Crop Germplasm Innovation and Utilization of Hunan Province, Hunan Agricultural University, Changsha, China

College of Bioscience and Biotechnology, Hunan Agricultural University, Changsha, China

National Institute of Agrobiological Sciences, Ibaraki305-8602, Japan,

Biological Information Research Center, National Institute of Advanced Industrial Science and Technology, Japan,

Japan Biological Informatics Consortium, Tokyo 135-0064, Japan,

Okayama University Graduate School of Medicine,Dentistry and Pharmaceutical Sciences, Innovation Center Okayama for Nanobio-targeted Therapy, Okayama 700-8558, Japan,

Department of Biological Sciences, Tokyo Metropolitan University, Tokyo 192-0397, Japan,

Center for Information Biology and DNA Data Bank of Japan, National Institute of Genetics, Research Organization of Information and Systems, Shizuoka 411-8540, Japan,

Institute of Botany, Academia Sinica,Taipei 11529, Taiwan,

Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, Shanghai 200233,China,

Cold Spring Harbor Laboratory, NY 11723,USA,

European Bioinformatics Institute, Wellcome Trust Genome Campus, Cambridge, CB10 1SD, UK,

Graduate School of Information Science and Technology, Hokkaido University, Hokkaido 060-0814,Japan,

Department of Plant Molecular Biology,University of Delhi South Campus, New Delhi 110021,India,

National Research Centre on Plant Biotechnology, Indian Agricultural Research Institute,New Delhi 110012, India,

Institute for Bioinformatics/MIPS, GSF National Research Center for Environment and Health, D-85764 Neuherberg, Germany,

Institute of the Society for Techno-innovation of Agriculture, Forestry and Fisheries, Ibaraki 305-0854, Japan,

Crop Research Informatics Laboratory, International Rice Research Institute, Metro Manila, Philippines,

Department of Biology, McGill University, Quebec H3A 1B1, Canada,

Tsukuba Division, Mitsubishi Space Software Co., Ltd., Ibaraki 305-0032, Japan,

Centre for Comparative Genomics, Murdoch University, Western Australia 6150, Australia,

Graduate School of Bioagricultural Sciences, Nagoya University, Nagoya 464-8601, Japan,

National Center for Biotechnology D1032 Nucleic Acids Research, 2008, Vol. 36, Database issue Information, National Institutes of Health, MD 20894,USA,

Pohang University of Science and Technology,Pohang 790-784, Korea,

RIKEN BioResource Center,RIKEN Tsukuba Institute, Ibaraki 305-0074, Japan,

Waksman Institute of Microbiology, RutgersUniversity, NJ 08854,

Stanford University MedicalCenter, CA 94305-5120, USA,

Swiss-Prot Group, Swiss Institute of Bioinformatics, Geneva 1206, Switzerland,

Research articles

Xianwen Zhang, Jiaping Li, Ailing Liu et al.Expression Profile in Rice Panicle: Insights into Heat Response Mechanism at Reproductive Stage[J]PLOS. ONE 2012 http://www.plosone.org/article/info%3Adoi%2F10.1371%2Fjournal.pone.0049652#pone-0049652-g010

Structured Information

Gene Name

Os01g0112400

Description

Major intrinsic protein family protein

Version

NM_001048348.1 GI:115434109 GeneID:4326119

Length

1125 bp

Definition

Oryza sativa Japonica Group Os01g0112400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 1

Location

Chromosome 1:644598..645722

Sequence Coding Region

644732..645418,645524..645697

Expression

GEO Profiles:Os01g0112400

Genome Context

<gbrowseImage1> name=NC_008394:644598..645722 source=RiceChromosome01 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008394:644598..645722 source=RiceChromosome01 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctag</cdnaseq>

Protein Sequence

<aaseq>MTTDHAGKKVDVVVVGNVDGEHVGVEQARHDLHEEAAAAAAADH HATRGLAIGFLIREVMVEGLASFLVVFWSCVAALMQEMYGTLTFPMVCLVVAMTVAFV LSWLGPAHFNPAVTITFAAYRRFPVWPKLPLYVAAQLAGSLLACLSVNAVMRPRHDHF YGTAPVVVHGTRLPFLMEFLASAVLMIVIATVATDGTAGKTVGGIAIGAAVGGLGLVI GPVSGGSMNPARTLGPAIVLGRYDGVWIYVVAPVAGMLVGALCNRAVRLSHRIVAFLC GTSVGIAGSP</aaseq>

Gene Sequence

<dnaseqindica>305..991#26..199#gaatgagatactaattaatactgaaatgacaacggatcatgccgggaagaaagtcgacgtcgtcgtggttggcaacgttgacggcgagcacgtcggagtagagcaagctcgccatgatctgcacgaggaggcggcggcggcggcggcggctgaccatcatgccaccagaggcctagccattggctttctcatacgagaggtaggtacatataatgtctgcaaatttatgattaattgatacacataaaaccctttgcatgaattgaattgaaccgatgaatggatggcaatggcgatggagcaggtgatggtggaggggttggcgtcgttcttggtggtgttctggtcgtgcgtggcggcgctgatgcaggagatgtacgggacgctgacgttcccgatggtgtgcctggtggtggcgatgacggtggcgttcgttctcagctggctcggcccggcgcacttcaacccggccgtcaccatcaccttcgccgcctaccgccgcttcccggtctggcccaagctgccgctctacgtcgccgcccagctcgccggctcgctcctcgcctgcctctccgtcaacgccgtcatgaggccgcgccacgaccacttctacggcacggcgcccgtcgtcgtccacggcacccgcctccccttcctcatggagttcctcgcctccgccgtcctcatgatcgtcatcgccaccgtcgccaccgacggcacagcggggaagacggtgggagggatcgccatcggagcggcggtgggagggctggggctggtgatcgggccggtgtcgggagggtcgatgaacccggcgaggacgctggggccggcgatcgtgctgggcaggtacgacggcgtgtggatctacgtggtggcgcccgtcgccgggatgctggtcggcgcgctctgcaaccgcgccgtcaggctctcccaccgcatcgtcgccttcctctgcggcacctctgttgggatcgccggctcgccctagctaccacactagagcttagccctccatatatatatccacagaataattcgcctccattatgatagctgcatgaacacgacgagcatcgctgcactgaaattgttttggaccaaccaatagagattttccatccc</dnaseqindica>

External Link(s)

NCBI Gene:Os01g0112400, RefSeq:Os01g0112400