Os04g0463400

From RiceWiki
Revision as of 10:27, 6 June 2014 by Littlescrew (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

OsVIT1 and OsVIT2 may function primarily in flag leaves to mediate vacuolar sequestration of Fe and Zn, due to highly expression levels of OsVIT1 and OsVIT2 in flag leaves rather than embryos. And they might also mediate allocation of Fe/Zn between flag leaves and the grains[1]. Knockdown of the vacuolar Fe transporter gene OsVIT1 or OsVIT2 may be useful to further increase the Fe concentration of seeds [2].

Expression

OsVIT2 locates in chromosome 4 with four exons and three introns as predicted, and encodes putative protein as the vacuolar iron transporter with 252 amino acids which shares 80.6% amino acid similarity with the VIT in Arabidopsis. There are five conserved transmembrane domains in OsVIT1 by further analyses. This gene expresses in flag leaf blades with a significantly high level[1]. different from OsVIT2 was quickly induced in rice seedling roots and shoots after the treatment of 4.5 mM FeSO4, OsVIT1 was not highly induced. Fe starvation caused downregulated OsVIT2 expression in roots and shoots, and no OsVIT1 response until 7 days after treatment in roots. These data suggest that OsVIT1 may represent a housekeeping mechanism for Fe accumulation in vacuoles, while OsVIT2 functions more in response to external Fe levels[1].

Subcellular localization

Figure 1.Subcellular localization of OsVIT1 and OsVIT2[1].(a–c) Bright-field images of Arabidopsis protoplasts expressing enhanced green fluorescent protein (EGFP) (a), OsVIT1: EGFP (b) and OsVIT2: EGFP(c).(d–f) Fluorescence images of Arabidopsis protoplasts expressing EGFP (d), OsVIT1: EGFP (e) and OsVIT2: EGFP(f).(g–i) Merged fluorescence images of EGFP (g), OsVIT1: EGFP (h) and OsVIT2: EGFP (i). Bars = 10μm.

OsVIT1 and OsVIT2 were localized to vacuolar membrane[1] when they combined with enhanced green fluorescent protein and expressed(Figure 1).

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

  • National Key Laboratory of Plant Molecular Genetics and National Center for Plant Gene Research (Shanghai), Institute of Plant Physiology and Ecology, Shanghai Institutes for Biological Sciences, Chinese Academy of Sciences, China
  • Zhejiang Province Key Laboratory of Technology for Improving Agricultural Product Quality, School of Agricultural and Food Science, Zhejiang Agriculture and Forest University, China

References

  1. 1.0 1.1 1.2 1.3 1.4 Yu Zhang, Yong-Han Xu, Hong-Yin Yi, and Ji-Ming Gong. Vacuolar membrane transporters OsVIT1 and OsVIT2 modulate iron translocation between flag leaves and seeds in rice. The Plant Journal (2012)72, 400–410.
  2. Hiroshi Masuda, May Sann Aung, and Naoko K Nishizawa. Iron biofortification of rice using different transgenic approaches. Rice 2013,6:40.

Structured Information

Gene Name

Os04g0463400

Description

Protein of unknown function DUF125, transmembrane family protein

Version

NM_001059545.1 GI:115458819 GeneID:4336075

Length

2850 bp

Definition

Oryza sativa Japonica Group Os04g0463400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 4

Location

Chromosome 4:23532796..23535645

Sequence Coding Region

23532960..23533260,23533526..23533640,23533773..23533858,23535286..23535542

Expression

GEO Profiles:Os04g0463400

Genome Context

<gbrowseImage1> name=NC_008397:23532796..23535645 source=RiceChromosome04 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008397:23532796..23535645 source=RiceChromosome04 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcggcggcgacggacggcggggggctgccgctgctggcggacaaggcggcgagccacagccaccaccaccacccggagcggcacttcacgtcgggggaggtggtccgcgacgtcatcatgggcgtctccgacggcctcaccgtgcccttcgccctcgccgcggggctctccggcgccagcgcgccatcctcgctcgtgctcaccgccggcctcgccgaggtcgccgccggcgccatctccatgggcctcggagggtatctcgcggccaagagcgaggcagaccattaccagcgggagatgaaaagggagcaggaggagatcatcgccgtcccggacactgaggctgctgagattggcgagatcatgtcgcagtacgggctcgaaccgcatgagtatggccctgtcgtggacgggctccgtaggaatcctcaagcttggctcgacttcatgatgaggtttgagctgggattggagaaaccagaccctaaaagagctatacagagcgctttaacaattgcgctatcttatgtcattggtggactggtccctctccttccctacatgtttatctccacagcacagaacgccatgctcacatctgtcggtgtcacgctggttgcactacttttctttggatacatcaagggtcgctttactggaaaccgtccattcctcagcgctgtccaaactgctattatcggtgcgcttgcttctgctgcggcatatggaatggccaaggccgtgcaaactagatga</cdnaseq>

Protein Sequence

<aaseq>MAAATDGGGLPLLADKAASHSHHHHPERHFTSGEVVRDVIMGVS DGLTVPFALAAGLSGASAPSSLVLTAGLAEVAAGAISMGLGGYLAAKSEADHYQREMK REQEEIIAVPDTEAAEIGEIMSQYGLEPHEYGPVVDGLRRNPQAWLDFMMRFELGLEK PDPKRAIQSALTIALSYVIGGLVPLLPYMFISTAQNAMLTSVGVTLVALLFFGYIKGR FTGNRPFLSAVQTAIIGALASAAAYGMAKAVQTR</aaseq>

Gene Sequence

<dnaseqindica>2386..2686#2006..2120#1788..1873#104..360#aaataaaccacctcttcaaacgtgcgtcgcctgaccgcttccatccatccaccagtctcgcttcttcgtgtctacggtctacctcggcgagtcggcggcggcgatggcggcggcgacggacggcggggggctgccgctgctggcggacaaggcggcgagccacagccaccaccaccacccggagcggcacttcacgtcgggggaggtggtccgcgacgtcatcatgggcgtctccgacggcctcaccgtgcccttcgccctcgccgcggggctctccggcgccagcgcgccatcctcgctcgtgctcaccgccggcctcgccgaggtcgccgccggcgccatctccatgggcctcggagggtaaacattaaacactcatcatctctctgtgtgttccttgtccatgcattgcacccctgaatccctgattaatctagcgaagttagcaatatgtcagtttcgtcgtatagatttgctcttcttttcttttttttttaaagaggggttccgagtttttcattaccaaaacaggaaacccagcggcagggtgcagtagtatgtcagtgaatacaatagaaagctttcggggacccacaggccacagcccataacatgatactagtaatttattaatcacctgaaatcggaatgtactgcagtatgatcatgatgaaacaaaaaattttgatacgccatgcacgcatatatttgctcgtacaattatcgggttccgtcttttgcagagacgcttaacacgtgtctgcgagaataggaaacaattcatacgattggtttgtccaatgatttttacaagatcctatgaaatcataaataatgatttataaaaaaatcctatggaatttctttcaaacaaaaggatctcttaagatgagatgaagattaagtttttcacgcaaaacttttggtattaacatataattgattgagttttaattattacaaacttgaaaaatagattaatatgatattttagagcaagtttcctatagaaagttttcacacgaaacgtacgttaagcaatttgaaaaacgtgccaaaaaattttaatgttcatccaactcttgttggagaaaagaacgagattgtctacggtttttttccctacagcctagaatattttccacgaccttgtagaacaggggagatgtggacaaggcataagcagtacagagtggagactgactggagagatggttgtaaatcgtattaggcgctcgcgcttaaaacatattacttgctgaatataagaagtggagtaatggattaataaaaaaaatggccagcaagcaagttaccgtgctcttggctgttttaatgggagttaggtatgcctgcctgaatatactcacagattcacaggtgtacttgctgaatattgccttgttacctcatgaaaaatcaattaggaaagcccatagtgttcgttgctctgcagattgtgcacggcgtatctgaccttctctgttctttgcctagctcccacccctacagtcccagttgcagattactcctgtcatccaaagcccgaaaaaggagtaattaaagtaaagttagctcgtgatggacacgtgtgtggccctataccacgtgctgttccagcacactttgtgttagtgtcacaacttttaggcctaagaaagtggagaataatactttcccccctttaaactgggaacaagacaagatcacattgttttcaaatcgaaaaaaggcgcgcgcaattgcacaaacgcatgacacttacccgcaattgcaccatgtggtaggtatctcgcggccaagagcgaggcagaccattaccagcgggagatgaaaagggagcaggaggagatcatcgccgtcccggacactggtaagccgataagcagatacaacaagataccatatgctgagacatgtcgctaagattcctcccatctgcgaccagcaggaaagctgcctcactttgtttaaaaaacttttggtttcctggttgatcgatcagaggctgctgagattggcgagatcatgtcgcagtacgggctcgaaccgcatgagtatggccctgtcgtggacgggctccgtaggaatcctcaagcttggctcgacttcatgatgaggtaatatgaccaactgttgctactccctttgtcaatctcttcatcagttatactagaaagcaaatgttgatgtcctgatggtgtctgagatactaatcagaaatgtttcgattatcctgtatgcgtttgccatagctcatataagaagctttcaacaatgaaaaccacacatatattagtaaacagcaagatttcaatcatataaaatataaaaattgatttggaattatcaaaccaacttaactaaccagagcaatgtatgcaggtttgagctgggattggagaaaccagaccctaaaagagctatacagagcgctttaacaattgcgctatcttatgtcattggtggactggtccctctccttccctacatgtttatctccacagcacagaacgccatgctcacatctgtcggtgtcacgctggttgcactacttttctttggatacatcaagggtcgctttactggaaaccgtccattcctcagcgctgtccaaactgctattatcggtgcgcttgcttctgctgcggcatatggaatggccaaggccgtgcaaactagatgatttgaaccctcatgtgttcctgtctgaagtttcagtaggcagaactgaatccaacgaagctgcaatgaatcacaatctcatattaagaatatgtattttacctttcatgtaacaaggaataaattttgggaaacatgaaataaaagcatgctattttaagttct</dnaseqindica>

External Link(s)

NCBI Gene:Os04g0463400, RefSeq:Os04g0463400