Os02g0534400

From RiceWiki
Revision as of 15:05, 6 June 2014 by Wangyh (talk | contribs) (Expression)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

OsCIN1, a rice CIN gene, is active in developing seeds. OsCIN1 has a critical role during the pre-storage phase, being involved in the proliferation of endosperm cells and longitudinal growth of immature seeds, rather than during the starch-filling phase.Cell-wall invertase (CIN) catalyzes the hydrolysis of sucrose into glucose and fructose for the supply of carbohydrates to sink organs via an apoplastic pathway.CINs are most active in the apoplast of sink organs,and can be involved in sucrose partitioning, control of cell differentiation and plant development, and responses to wounding and pathogen infection.[1] The cDNA, designated OsCIN1, contains an open reading frame of 1731 bp encoding a polypeptide of 577 amino acid residues. The deduced amino acid sequence showed typical features of the cell wall invertases, including a β-fructosidase motif and a cysteine catalytic site, and shared 78.6 and 73.7% identity with maize cell wall invertases, Incw1 and Incw2, respectively.[2]

Expression

OsCIN1 transcript is detectable only in the very early stage of their development, 1-4 d after flowering, when the cell wall invertase activity is the highest and the increase in caryopsis length is rapid. In situ localization of the mRNA revealed that OsCIN1 is expressed preferentially in the vascular parenchyma of the dorsal vein, integument and its surrounding cells, and is expressed weakly in the nucellar projection and nucellar epidermis.[2] OsCIN1 was highly expressed in the ovary and at the veryearly developmental stage of the seed (1–2 DAF). Levels of OsCIN1 transcript dramatically decreased during 5–8 DAF and were weak thereafter.[1] Drought stress near heading reduces grain yield in rice cultivars by inhibiting processes such as anther dehiscence and panicle exsertion. Because cell-wall invertases play an important role in carbon allocation to developing organs, we examined the tissue-specific expression and drought sensitivity of the corresponding genes (OsCIN1-9) at heading in the widely grown cultivar IR64. OsCIN1-5,8 were expressed to varying degrees in flag leaf, panicle, anthers and peduncle at 1 day before heading (1 DBH). When water was withheld for 2 days starting 3 DBH, anthesis and peduncle elongation were halted. At the same time, transcript levels for OsCIN1-5,8 genes were all markedly down-regulated in anthers and/or peduncles but were not affected in flag leaves. Re-watering allowed anthesis and peduncle elongation to proceed and restored expression of OsCIN1-5,8.[3]

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

  1. 1.0 1.1 Cho JI, Lee SK, Ko S, Kim HK, Jun SH, Lee YH, Bhoo SH, Lee KW, An G, Hahn TR, Jeon JS.Molecular cloning and expression analysis of the cell-wall invertase gene family in rice (Oryza sativa L.).Plant Cell Rep. 2005 Jun;24(4):225-36.
  2. 2.0 2.1 Hirose T, Takano M, Terao T.Cell wall invertase in developing rice caryopsis: molecular cloning of OsCIN1 and analysis of its expression in relation to its role in grain filling.Plant Cell Physiol. 2002 Apr;43(4):452-9.
  3. Cite error: Invalid <ref> tag; no text was provided for refs named ref3

Structured Information

Gene Name

Os02g0534400

Description

Cell wall invertase (EC 3.2.1.26)

Version

NM_001053569.1 GI:115446508 GeneID:4329561

Length

4704 bp

Definition

Oryza sativa Japonica Group Os02g0534400, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 2

Location

Chromosome 2:20540408..20545111

Sequence Coding Region

20540467..20540653,20541522..20541530,20542166..20543019,20543200..20543358,20543758..20544005
,20544305..20544395,20544534..20544719

Expression

GEO Profiles:Os02g0534400

Genome Context

<gbrowseImage1> name=NC_008395:20540408..20545111 source=RiceChromosome02 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008395:20540408..20545111 source=RiceChromosome02 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggggactcggctcttggcgctcgcgccatggctgctgctgctcctcctgcagctcgccggcgcgtcccatgtcgtccaccggagcctcgaggccgagcaggcgccgagctcggtgccggcctccattgtcagccccctgctcaggacaggataccacttccagcccccgatgaactggatcaacgatccgaacgggccactgtattacaagggatggtaccacctattctaccagtacaaccccaagggagctgtgtggggcaatatcgtgtgggctcactcggtatcacaggacctcatcaactggatagcccttgagccggcaatcaagcccgacatcccctccgaccagtacggttgttggtctggctctgccaccatccttcccgatggcacgccggcgatcctctacactgggatcgaccgccccaacatcaactaccaggtgcagaatatcgcatttcccaagaatgcgtcagacccgctccttcgtgagtgggtcaagccggcctacaacccggtggccacgccggagcctggtatgaacgcaacgcaattccgcgatccgacaacggcctggtacgccgacggtcattggcggatgctcgttggtggcctgaagggggctcgcctcggccttgcctacctctaccggagccgggacttcaagacatgggttcgggccaagcacccactccattcggcgctcactgggatgtgggagtgcccagacttctttccgttgcaagcaccaggtctccaggctggcctcgacacatctgtgccgagcagcaagtacgtgctcaagaacagcctcgatctcacccgttatgactactacacggtgggcatctacaacaaggtgacggagcggtatgtgccggacaaccctgctggcgactaccaccggctccgctatgactacggcaacttctacgcatcaaagaccttcttcgacccggtgaagcaccgccgcatcctgcttgggtgggctaacgagtccgacagcgtcacctacgacaaggcgaagggctgggccggcatccatgcgatcccaagaaaggtatggctggacccgagcgggaagcagcttctgcagtggccaatcgaggagctggagacgctgaggggcaaatcggtcagcgtctttgacaaggtggtgaagcccggggaacatttccaagtcacgggcctcggaacctaccaggctgacgtggaggtgagcttggaggtgtccgggctggagaaggcggaggcgttggacccggcgttcggcgacgacgcggagaggctgtgcggcgcgaagggcgcggacgtgaggggcggcgtggtgttcgggctgtgggtgctggcctccgccggcctggaggagaaaaccgccgtcttcttccgcgtcttcaagccggccgggcacggcgccaagcccgtcgtcctcatgtgcaccgaccctaccaagtcttctcttagcccggatctctacaagccaacttttgccgggttcgtcgacaccgacatctcgtccgggaagatctccttgagaagcttgattgaccgttcggtggttgagagcttcggcgccgggggcaagacctgcatcctgtcgagagtttacccgtcgatggcgataggtgacaaggcccatctttacgtcttcaacaatggggaggcggatattaagatttcacatctgaaagcgtgggaaatgaagaagccgcttatgaatggcgcctaa</cdnaseq>

Protein Sequence

<aaseq>MGTRLLALAPWLLLLLLQLAGASHVVHRSLEAEQAPSSVPASIV SPLLRTGYHFQPPMNWINDPNGPLYYKGWYHLFYQYNPKGAVWGNIVWAHSVSQDLIN WIALEPAIKPDIPSDQYGCWSGSATILPDGTPAILYTGIDRPNINYQVQNIAFPKNAS DPLLREWVKPAYNPVATPEPGMNATQFRDPTTAWYADGHWRMLVGGLKGARLGLAYLY RSRDFKTWVRAKHPLHSALTGMWECPDFFPLQAPGLQAGLDTSVPSSKYVLKNSLDLT RYDYYTVGIYNKVTERYVPDNPAGDYHRLRYDYGNFYASKTFFDPVKHRRILLGWANE SDSVTYDKAKGWAGIHAIPRKVWLDPSGKQLLQWPIEELETLRGKSVSVFDKVVKPGE HFQVTGLGTYQADVEVSLEVSGLEKAEALDPAFGDDAERLCGAKGADVRGGVVFGLWV LASAGLEEKTAVFFRVFKPAGHGAKPVVLMCTDPTKSSLSPDLYKPTFAGFVDTDISS GKISLRSLIDRSVVESFGAGGKTCILSRVYPSMAIGDKAHLYVFNNGEADIKISHLKA WEMKKPLMNGA</aaseq>

Gene Sequence

<dnaseqindica>60..246#1115..1123#1759..2612#2793..2951#3351..3598#3898..3988#4127..4312#catccctttctgcccctcgtcttctccccctccctggccggcctgtctagtacaaaacaatggggactcggctcttggcgctcgcgccatggctgctgctgctcctcctgcagctcgccggcgcgtcccatgtcgtccaccggagcctcgaggccgagcaggcgccgagctcggtgccggcctccattgtcagccccctgctcaggacaggataccacttccagcccccgatgaactggatcaacggtaagcaaagattgtgctcagctagcttctctgaacttttggatgttcttcagttcctctttgtcttggtttcttcgacatcttctcttcaaagcttggtttgttttggtttcttcttatcttcagtattagctatagcttagctttattacataactagtacaagaaaatatcatgccatagacgaacaaagcaatacatggctctgaattttagctgatgtactccctccgtttcagtttataagatgttttggctttggtcaaaatctaactgcttcaaatttgatcaaatttatagaaaataataataatattttaaagccaagataaatttatttaaaaatatatttaattattaatttaataaaactaattttgtaatgtaaatattattatatttgtctataaacttagtaatctgaaacggagggagtatgcaagtagtactttgcaccttggtaaaaaattaaaacagcttctgtggttagtggtttaatctcgtgttaatctacataaccgctggtgatttctggtggacaaaaaaattacagcttgctgagttatcaactttatattggctatgttagttaggtagtcctgcagttgttttcttctccatcagaaaagtcaagctgcaggcttttaagttatcacagtatccgacaacggtgaagacttgcagttcagcaagtacccgaataataatacaccagctttgtttttgagcattaagctaataactcttgattgatacctaattgatgcttgctgcaattatactgttctaactcgatttttttatttctcttcttgtgtctggttctgatcatatcgctgcgactgcaaattaatctcatcgacgacagatccgaacggtacgaattttccggcccacttcttgcaaattatctctgtcttgttctgcctactagatctatgatgttgagagtataatgaacagcaacgcttgtgtgcatgtgttttttaaatatgggaagattaaagaccaattttttagaaggagctaagagaaaggacagtttaacattaaaatggtgcatgccggcacgcacatgctgcaaggcgaatgcgtatatacaacggcctcttgcagtaggcagaaaaatttaagctggtcaagctttcgaagtttggtcttaaaatttgacaatgggatcaatcaacggattcctttggcgtatcactgtctggaagtgaatctcaatttgattatacgaatttagacatgacaagacataatcaatttcacaataaactttaatttaaacaactcatttttgtaaaacagtaaagaaaccatataaaaagtgataagttgataagcaataagttgtacctgtacacaagaatagatctaattaacatgtgtactatgggctcccccccccaacccccacccccaccccaaaaaaaaattgggggatccgccccagttatacatgaaaaatgttttgagcttttgagttgataagttgagaacattgaacagggccactgtattacaagggatggtaccacctattctaccagtacaaccccaagggagctgtgtggggcaatatcgtgtgggctcactcggtatcacaggacctcatcaactggatagcccttgagccggcaatcaagcccgacatcccctccgaccagtacggttgttggtctggctctgccaccatccttcccgatggcacgccggcgatcctctacactgggatcgaccgccccaacatcaactaccaggtgcagaatatcgcatttcccaagaatgcgtcagacccgctccttcgtgagtgggtcaagccggcctacaacccggtggccacgccggagcctggtatgaacgcaacgcaattccgcgatccgacaacggcctggtacgccgacggtcattggcggatgctcgttggtggcctgaagggggctcgcctcggccttgcctacctctaccggagccgggacttcaagacatgggttcgggccaagcacccactccattcggcgctcactgggatgtgggagtgcccagacttctttccgttgcaagcaccaggtctccaggctggcctcgacacatctgtgccgagcagcaagtacgtgctcaagaacagcctcgatctcacccgttatgactactacacggtgggcatctacaacaaggtgacggagcggtatgtgccggacaaccctgctggcgactaccaccggctccgctatgactacggcaacttctacgcatcaaagaccttcttcgacccggtgaagcaccgccgcatcctgcttgggtgggctaacgagtccgacagcgtcacctacgacaaggcgaagggctgggccggcatccatgtaaatcatagttacaattttgcaatcctaatttcttgtactacctacctccacaaatgtttgatgttattagttatcttaatttcaagagctaaccaaacgtaaaagaaaaattggagggactagaggtttaattagaattgatttggagattgatggcttggcttgtgtcgttggcaggcgatcccaagaaaggtatggctggacccgagcgggaagcagcttctgcagtggccaatcgaggagctggagacgctgaggggcaaatcggtcagcgtctttgacaaggtggtgaagcccggggaacatttccaagtcacgggcctcggaacctaccaggttgctacactacaaaatcaaaaaccagtaacttgaaatttccatccacaagaaaatgagactagaatattggccatatatattgctgccgtcaagggccccatgtgcaggagcttcctagttatacggagtactagctaagctcgctccggtccaattccgtatgggcagcgatcatcgcgtgcccaattcctgctcgtgcacgcgaagatcgcgaagtcgccggaccggcgatttttccgctcggtcggcgtcagcttccgctcccgcccgtttcaccttcaacggcgtggacgcatccggttggccggagaggaacctgcaacgcatcgcatattcgccttctaggtgtgacgctgacgcttacaagttttgctttgatatttgtgtgtcgatcaggctgacgtggaggtgagcttggaggtgtccgggctggagaaggcggaggcgttggacccggcgttcggcgacgacgcggagaggctgtgcggcgcgaagggcgcggacgtgaggggcggcgtggtgttcgggctgtgggtgctggcctccgccggcctggaggagaaaaccgccgtcttcttccgcgtcttcaagccggccgggcacggcgccaagcccgtcgtcctcatgtgcaccgaccctaccaagtacgataccactaccagccaaatctatactactaccttgtgatgtctcggtacaatgcaagcagcacacatgcatatacccatcctgcatgcactgatcaatgtctgccacgttttcaaaaaaaaaatgagagaagaaatacatgatcttagagttggaatcacacaccctttatcacagcactatcaaatacgtctcctgtcacattttcgcaattacccaaacacagtagacaacttaaaatgctaaatccaaagctctgaagttgattaattactgtcctttttttattgagcaggtcttctcttagcccggatctctacaagccaacttttgccgggttcgtcgacaccgacatctcgtccgggaagatctccttgagaagcttggtatagtacacacatatactacgagcttaattaaccacgttttttattagtgcctctcgtatataacttaccaatgctttattgactgtgaccatgattagtcttatatatgcatcattgtttgtgacttcgtttcagattgaccgttcggtggttgagagcttcggcgccgggggcaagacctgcatcctgtcgagagtttacccgtcgatggcgataggtgacaaggcccatctttacgtcttcaacaatggggaggcggatattaagatttcacatctgaaagcgtgggaaatgaagaagccgcttatgaatggcgcctaattaatttgccgcggatatatatgatggcgactttaattaattgctattattaaatcatcactcgccatctgcgatataccggccagatcgtccctgacatcgatctcctgttcttggccgatgttgcacgctgcacgatatttgattgcttgttgctgaggatgattggagtttgtattcgtgtctccagatatcgaaagaccagggtaattttacactcttcttgtacaattaattgattgtatcacgagttgtttgtaaacaattgtttgtatcacgagttgtttgcaaacatttgtttgtaccacgatcgagttgtgtgacaaataaattaagatgctgattatttcatcatgttacagataataaagaggttttccgtgatttacttc</dnaseqindica>

External Link(s)

NCBI Gene:Os02g0534400, RefSeq:Os02g0534400