OrfB

From RiceWiki
Revision as of 15:34, 6 June 2014 by Hui Sun (talk | contribs) (Function)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Hypothetical protein

Mutation

Expression

Please input expression information here. Editing of the orfB transcripts (a) The fertile line Mitochondrial RNA editing of the orfB transcript was assessed in the fertile rice line. Fourteen cDNA clones obtained from cDNA library of fertile rice line were sequenced. Determination of the orfB cDNA sequence from overlapping clones from the cDNA library showed four C®T conversions within the coding region relative to the orfB genomic sequence.

Evolution

Knowledge Extension

Please input evolution information here.

You can also add sub-section(s) at will. orfB transcripts of the sterile line have identical 3’ ends with that of transcripts from the fertile lines The basis of the observed differences in the orfB gene transcripts between the sterile and fertile lines was determined using 3’ RACE. The forward primer OGSP1 (Figure 4) annealed 180 bp downstream of the initiation codon in the coding region of the orfB gene. In both the fertile and sterile rice lines, one amplified band of ~400 bp was obtained

Labs working on this gene

Please input related labs here.

References

Please input cited references here. 1. Eckardt NA: Cytoplasmic male sterility and fertility restoration. Plant Cell 2006, 18:515-517. 2. Hanson MR: Plant mitochondrial mutation and male sterility. Annu Rev Genet 1991, 25:461-486. 3. Hanson MR, Bentolila S: Interactions of mitochondrial and nuclear genes that affect male gametophyte development. Plant Cell 2004, 16:154-169. 4. Schnable PS, Wise RP: The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 1998, 3:175-180. 5. Chase CD, Babay-Laughnan S: Cytoplasmic male sterility and fertility restoration by nuclear genes. Molecular Biology and Biotechnology of Plant Organelles Springer-VerlagDaniell H, Chase CD 2004, 593-622. 6. Gutierres S, Combettes B, De Paepe R: In the Nicotiana sylvestris CMSII mutant, a recombination-mediated change 5’ to the first exon of the mitochondrial nad1 gene is associated with lack of the NADH: ubiquinone oxidoreductase (complex I) NADI subunit. Eur J Biochem 1999, 216:361-370. 7. Unseld M, Marienfeld JR, Brandt P, Brennicke A: The mitochondrial genome of Arabidopsis thaliana contains 57 genes in 366,924 nucleotides. Nature Genet 1997, 15:57-61.

Gene Name

orfB

Description

ORFB protein

Version

GeneID:6450152

Length

468 bp

Definition

Oryza sativa Japonica Group orfB, Mitochondrion gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Mitochondrion

Location

Mitochondrion:53424..53891

Sequence Coding Region

53424..53891

Genome Context

<gbrowseImage3> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage3>

Gene Structure
(RNA Editing)

<gbrowseImage2> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2>

Protein Sequence

<aaseq>MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDPKNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQILYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII</aaseq>

Gene Sequence

<dnaseqindica>1..468#atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctctttagtttttatattctcttattaaataataataatggaatacttggaattagcagaattctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccctaagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactccagtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaaatcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagattctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaaaaaataatgctcacacatgttccacacgggcaaggaagcataatctaa</dnaseqindica>

External Link(s)

NCBI Gene:orfB