Os03g0222600

From RiceWiki
Revision as of 15:38, 6 June 2014 by Wangxiaoyang113 (talk | contribs) (References)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

Please input function information here. Gene type:protein coding RefSeq status:PROVISIONAL We present here the annotation of the complete genome of rice Oryza sativa L. ssp. japonica cultivar Nipponbare. All functional annotations for proteins and non-protein-coding RNA (npRNA) candidates were manually curated. Functions were identified or inferred in 19,969 (70%) of the proteins, and 131 possible npRNAs (including 58 antisense transcripts) were found. Almost 5000 annotated protein-coding genes were found to be disrupted in insertional mutant lines, which will accelerate future experimental validation of the annotations. The rice loci were determined by using cDNA sequences obtained from rice and other representative cereals. Our conservative estimate based on these loci and an extrapolation suggested that the gene number of rice is approximately 32,000, which is smaller than previous estimates. We conducted comparative analyses between rice and Arabidopsis thaliana and found that both genomes possessed several lineage-specific genes, which might account for the observed differences between these species, while they had similar sets of predicted functional domains among the protein sequences. A system to control translational efficiency seems to be conserved across large evolutionary distances. Moreover, the evolutionary process of protein-coding genes was examined. Our results suggest that natural selection may have played a role for duplicated genes in both species, so that duplication was suppressed or favored in a manner that depended on the function of a gene.

Expression

Sequence:Chromosome: 3; NC_008396.2 (6445239..6447907)

Location: chromosome: 3

Evolution

OrganismOryza sativa Japonica Group (cultivar: Nipponbare)

LineageEukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta; Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP clade; Ehrhartoideae; Oryzeae; Oryza

Labs working on this gene

Please input related labs here.

References

1.The Rice Annotation Project Database (RAP-DB): 2008 update. Rice Annotation Project, et al. Nucleic Acids Res, 2008 Jan. PMID 18089549, Free PMC Article

2.Curated genome annotation of Oryza sativa ssp. japonica and comparative genome analysis with Arabidopsis thaliana. Rice Annotation Project, et al. Genome Res, 2007 Feb. PMID 17210932, Free PMC Article

3.The Rice Annotation Project Database (RAP-DB): hub for Oryza sativa ssp. japonica genome information. Ohyanagi H, et al. Nucleic Acids Res, 2006 Jan 1. PMID 16381971, Free PMC Article

4.The map-based sequence of the rice genome. International Rice Genome Sequencing Project. Nature, 2005 Aug 11. PMID 16100779

Structured Information

Gene Name

Os03g0222600

Description

Caleosin related family protein

Version

NM_001055954.2 GI:297600557 GeneID:4332103

Length

2669 bp

Definition

Oryza sativa Japonica Group Os03g0222600, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 3

Location

Chromosome 3:6445239..6447907

Sequence Coding Region

6445324..6445388,6445553..6445707,6446247..6446404

Expression

GEO Profiles:Os03g0222600

Genome Context

<gbrowseImage1> name=NC_008396:6445239..6447907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008396:6445239..6447907 source=RiceChromosome03 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcgaccctactacttattgcttgcctccccacccggcgcccccatctctctttgcgccaaagatcctacaaactcgccccccgaataaccatggcgtcgtcttcgtcgtcgtcgccgccgtcgtctgacccgtccttggagacggtagcgccgcacgcggctgttacgggggagcggaagctcaaccccaacctgcaggagcagcttcccaagccatatctcgcgagggctctcgcggcggtggacccgagccacccgcaggggacccgtgggcgcgacgcccgcggcatgagcgtgctccagcagcacgccgcgttcttcgaccgcaacggcgacggcatcatctacccctgggagaccttccaaggtgagtga</cdnaseq>

Protein Sequence

<aaseq>MATLLLIACLPTRRPHLSLRQRSYKLAPRITMASSSSSSPPSSD PSLETVAPHAAVTGERKLNPNLQEQLPKPYLARALAAVDPSHPQGTRGRDARGMSVLQ QHAAFFDRNGDGIIYPWETFQGE</aaseq>

Gene Sequence

<dnaseqindica>86..150#315..469#1009..1166#gaaggcgaaggcggaggatttcggctagcttggtgatgctgccgttcgcgagcattttaaatacggtgtgggggcgttcctcctaatggcgaccctactacttattgcttgcctccccacccggcgcccccatctctctttgcgccaaaggtaatccatccatcgaatcctgcatcttttttgcttgtgccttgtgttgcaaagcagtcttggattccttctgttcgcattgccctgagagttctagttcgatccccaactaagagcgttttgttttcgtttttcttctgttcgttcgttctttcgatctgcagatcctacaaactcgccccccgaataaccatggcgtcgtcttcgtcgtcgtcgccgccgtcgtctgacccgtccttggagacggtagcgccgcacgcggctgttacgggggagcggaagctcaaccccaacctgcaggagcagcttcccaagccatgtaagcgattctatttctaccatgcagggatcgaaaaaaaaactgttctttctttctatctttctttttctttctcgatcgtctttgatgtctttggtcagtggtcactgaacactgataacctgataagagagtgagaggccggagttggctgcaaagcacgcggttgtgcgtgacggcagctcgacgtacatcagttgagacttgagagatcatatggtttaagtaccaacagaaagaatgtgtaattttaccatttaatttctctagatactacgtatttcgatgtactaaaatttttaagtattataaaatcttgatatctcaatgtactttgtcaagtaacgtaaaatttctgaaatttctcagaaagtatacatgagagcagtagcaccgctagtgctttactggtactgcatcatctgttacagtgcagaaaaattactaccgctccagtaactgatcctaaacctgatgtcgtaaccgtagccagctaactgctgctgtttttttttctttctgggttcgcgtgcgcgcagatctcgcgagggctctcgcggcggtggacccgagccacccgcaggggacccgtgggcgcgacgcccgcggcatgagcgtgctccagcagcacgccgcgttcttcgaccgcaacggcgacggcatcatctacccctgggagaccttccaaggtgagtgagtgagcgagcgagtgagtgatccgcccgtgtgtcttgctgtggatgaactctccacgtcgcgatcagtccatctctctctgctgctgctatatctgtgtcccgtttcggacaggcaaacagtttgccttctaaggttgtaattaagcttgacgcaacagaagagattaagagattttagggtcgcgtgttaagtcagaattatgcttccaaatcaacgattgcttgtgcagtgcagatgtagtatgagactttgagtatatggtatgttttgttttttgtttttcacagggctgagagcgataggttgcgggtatcccgtgtcgattgctggtgccatactcatcaacctcgtcctcagctatcctactcaaccggtaaagtttgccctctgtactccacgtgctccttattttcaatactttttaccaacatatatgccgtgccttttgctgtattgccaaactgtgtgatcatatctggactaatcttacgtcaaaaaaaaaatctggactaatcttctcgattatgatgtaaagaaattgtataatgttttttagggcgttctgaattttatatgttggtctgaatgttacaccaccttcttttgtaaatgtgaagaggtgtcactaggctagtgaaaattgaattgtagtgacttttgtaagtgggaagacatatctatcttcacttcaggctttggatttgatgtgtttttttatggaggggccaacatgtacagatgaacttatgtttactttctttcaaatgcaggggtggatgccttctcctctgttttccatccatataaagaacattcacaagggtaagcatgggagtgactctgaagcatatgatactgaagggaggtatgtaactttgtatacataattgttaagttcctctctttgcctagaaacgattacaatttctatctcgtttcaaatttctcactaatttatatgcttttactaggtttgatccatcgaaatttgatgctatattcagcaagtatggcagaactcatccaaatgctttgacaaaagatgagctgaactcgatgattaaagcaaaccgcaatatgtatgatttcattggctggtaagcggatggttgaattagcagtaccgttcgccatcatttttttttttcagttacaactttgctaattggttcttcctgcaaaccatcacaggattactagcgctggtgaatggatgctactgtacagcgtggccaaggataaagaagggctgttgcaacgagaaactgttagaggcgccttcgatggcagcctgtttgagcgacttcaggacagcaagaaatctgcttgaatatagcaatgagctgtgctgctcgaagaaagcgttgacagtaaagaatctaataagattagaaaaaaaaagggtctttgctttgtgtaattcaaatgaaaaatgttaattaccccatgacagtatttatgatgtttgcaatgatcaccacctcatgatatagtcttgttc</dnaseqindica>

External Link(s)

NCBI Gene:Os03g0222600, RefSeq:Os03g0222600