OrfB
Please input one-sentence summary here.
Contents
Annotated Information
Function
Hypothetical protein
Mutation
Experimental evidence for polymorphisms in orfB structural organization and mitochondrial transcript profiles of the orfB gene in the CMS-WA rice system. The sterile line orfB gene transcript profile was characterized by two transcripts of ~1.1 kb and ~0.7 kb, and one ~0.7 kb transcript was detected in the fertile lines. The ~1.1 kb transcript present in the sterile line remained unedited. However, in the presence of nuclear encoded restoration of fertility (Rf) gene(s) in fertile restored hybrid lines (APMS-6A × BR-1870; F1 generation), the ~1.1 kb orfB transcripts were fully edited. The editing of the orfB gene ~1.1 kb transcript co-segregated with fertility restoring alleles in a segregating population of F2 progeny of restored hybrid F1 plants. RFLPs were observed for the orfB gene (Figure 2A) in the mitochondrial genome between the sterile and the fertile lines. All restriction enzymes with the exception of EcoRI gave rise to a single hybridizing band with size variation between the sterile and fertile lines. Due to the presence of an EcoRI site in the orfB gene probe, digestion with EcoRI consistently generated two bands in all rice lines. The length of one band varied between the sterile and the fertile lines. Therefore, it was evident that mitochondrial orfB gene was present as a single copy with differential organization in the sterile and fertile lines.
Expression
Please input expression information here. Editing of the orfB transcripts (a) The fertile line Mitochondrial RNA editing of the orfB transcript was assessed in the fertile rice line. Fourteen cDNA clones obtained from cDNA library of fertile rice line were sequenced. Determination of the orfB cDNA sequence from overlapping clones from the cDNA library showed four C®T conversions within the coding region relative to the orfB genomic sequence.
Evolution
Knowledge Extension
Please input evolution information here.
You can also add sub-section(s) at will. orfB transcripts of the sterile line have identical 3’ ends with that of transcripts from the fertile lines The basis of the observed differences in the orfB gene transcripts between the sterile and fertile lines was determined using 3’ RACE. The forward primer OGSP1 (Figure 4) annealed 180 bp downstream of the initiation codon in the coding region of the orfB gene. In both the fertile and sterile rice lines, one amplified band of ~400 bp was obtained
Labs working on this gene
Please input related labs here.
References
Please input cited references here. 1. Eckardt NA: Cytoplasmic male sterility and fertility restoration. Plant Cell 2006, 18:515-517. 2. Hanson MR: Plant mitochondrial mutation and male sterility. Annu Rev Genet 1991, 25:461-486. 3. Hanson MR, Bentolila S: Interactions of mitochondrial and nuclear genes that affect male gametophyte development. Plant Cell 2004, 16:154-169. 4. Schnable PS, Wise RP: The molecular basis of cytoplasmic male sterility and fertility restoration. Trends Plant Sci 1998, 3:175-180. 5. Chase CD, Babay-Laughnan S: Cytoplasmic male sterility and fertility restoration by nuclear genes. Molecular Biology and Biotechnology of Plant Organelles Springer-VerlagDaniell H, Chase CD 2004, 593-622. 6. Gutierres S, Combettes B, De Paepe R: In the Nicotiana sylvestris CMSII mutant, a recombination-mediated change 5’ to the first exon of the mitochondrial nad1 gene is associated with lack of the NADH: ubiquinone oxidoreductase (complex I) NADI subunit. Eur J Biochem 1999, 216:361-370. 7. Unseld M, Marienfeld JR, Brandt P, Brennicke A: The mitochondrial genome of Arabidopsis thaliana contains 57 genes in 366,924 nucleotides. Nature Genet 1997, 15:57-61.
| Gene Name |
orfB |
|---|---|
| Description |
ORFB protein |
| Version |
GeneID:6450152 |
| Length |
468 bp |
| Definition |
Oryza sativa Japonica Group orfB, Mitochondrion gene. |
| Source |
Oryza sativa Japonica Group ORGANISM Oryza sativa Japonica Group
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
clade; Ehrhartoideae; Oryzeae; Oryza.
|
| Chromosome | |
| Location |
Mitochondrion:53424..53891 |
| Sequence Coding Region |
53424..53891 |
| Genome Context |
<gbrowseImage3> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage3> |
| Gene Structure (RNA Editing) |
<gbrowseImage2> name=NC_011033:53424..53891 source=Rice_Japonica_Mitochondrion preset=GeneLocation </gbrowseImage2> |
| Protein Sequence |
<aaseq>MPQLDKLTYFSQFFWLCLFFFSFYILLLNNNNGILGISRILKLRNQLLSHRGNKIRFKDPKNLEDILRKGFSTGLSYMYSSLSEVSQWCKTVDYLGKRRKITLISDFGEISGSRGMERQILYLISKSSYNTSSSRITCWKKIMLTHVLHGQGSII</aaseq> |
| Gene Sequence |
<dnaseqindica>1..468#atgcctcaacttgataaattgacttatttctcacaattcttctggttatgccttttcctctttagtttttatattctcttattaaataataataatggaatacttggaattagcagaattctcaaactacggaaccaactgctttcgcaccgggggaacaagatccgtttcaaggaccctaagaatttggaagatatctcgagaaaaggttttagcaccggtctctcatatatgtactccagtttatccgaagtatcccaatggtgtaagaccgtcgactatttgggaaaaaggaggaaaatcactctgatctcagatttcggagaaataagtggctcacgaggaatggagagacagattctctatttgatctcgaagtcctcatataacacttcttccagtcggatcacttgttggaaaaaaataatgctcacacatgttccacacgggcaaggaagcataatctaa</dnaseqindica> |
| External Link(s) |
