Os10g0403000

From RiceWiki
Revision as of 01:33, 7 June 2014 by Hancychan (talk | contribs)
Jump to: navigation, search

Please input one-sentence summary here.

Annotated Information

Function

The molecular basis of plastochron regulation remains to be uncovered. plastochron 1 (pla1) is the first mutant that drastically alters plastochron, in which leaf primordia are formed approximately twofold faster than in the wild type. Concomitantly, leaves of pla1 become short, suggesting that PLA1 regulates organ size. The PLA1 gene encodes a cytochrome P450 family protein (CYP78A11). An Arabidopsis homolog of PLA1, KLUH, was shown to regulate organ size. Subsequently, the PLA2 and PLA3 genes, loss-of-function mutants of which exhibit similar phenotypes to that of pla1, were identified. These encode an RNA-binding protein and glutamate carboxypeptidase, respectively. Interestingly, PLA1 and PLA2 are expressed in young leaf primordia, but not in shoot meristems. Therefore, based on analyses of the developmental processes of leaves, the primary functions of PLA1 and PLA2 are suppression of precocious leaf maturation, and that some non-cell autonomous signals move from leaf primordial through shoot meristems to suppress the formation of a new leaf primordium. Thus, PLA1 and PLA2 are key genes for elucidating leaf development.

PLA1 and PLA2 show several phenotypes likely related to phytohormones, such as small leaf size, dwarfism and enlarged SAM. In addition, the phytohormone (CK, abscisic acid and IAA) contents of pla mutants differed from those of the wild type. These mutant phenotypes suggest that PLA genes have some relationship with phytohormones.

Expression

PLA1 and PLA2 gene expression is associated with GA signaling. Thus, we examined the effect of GA on PLA1 and PLA2 gene expression. Ten-day-old seedlings were treated with 10 lM GA3 and PLA gene expression was monitored for 24 h by real-time PCR. PLA1 and PLA2 expression increased as early as 3 h after treatment, and a high level of expression was maintained for 24 h (Fig. 3a). To investigate the longterm effect of GA, wild-type seeds were inoculated and grown for 8 days on culture media containing 10 lM GA3. PLA1 and PLA2 expression was maintained at a high level for 8 days (Fig. 3b). Next, we examined the effect of uniconazole, a GA biosynthesis inhibitor. Uniconazole treatment markedly suppressed PLA1 and PLA2 gene expression (Fig. 3b). Therefore, GA regulates the expressions of both PLA1 and PLA2.

Evolution

Please input evolution information here.

You can also add sub-section(s) at will.

Labs working on this gene

Please input related labs here.

References

1 Manaki Mimura;Yasuo Nagato;Jun-Ichi Itoh, Rice PLASTOCHRON genes regulate leaf maturation downstream of the gibberellin signal transduction pathway, Planta, 2012, 235(5): 1081-1089 2 Kazumaru Miyoshi;Byung-Ohg Ahn;Taiji Kawakatsu;Yukihiro Ito;Jun-Ichi Itoh;Yasuo Nagato;Nori Kurata, PLASTOCHRON1, a timekeeper of leaf initiation in rice, encodes cytochrome P450, Proceedings of the National Academy of Sciences, 2004, 101(3): 875-880 3 Jun-Ichi Itoh;Atsushi Hasegawa;Hidemi Kitano;Yasuo Nagato, A Recessive Heterochronic Mutation, plastochron1, Shortens the Plastochron and Elongates the Vegetative Phase in Rice, The Plant Cell, 1998, 10(9): 1511-1522

Structured Information

Gene Name

Os10g0403000

Description

Cytochrome P450 78A11

Version

NM_001071087.1 GI:115481917 GeneID:4348574

Length

1754 bp

Definition

Oryza sativa Japonica Group Os10g0403000, complete gene.

Source

Oryza sativa Japonica Group

 ORGANISM  Oryza sativa Japonica Group
           Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
           Spermatophyta; Magnoliophyta; Liliopsida; Poales; Poaceae; BEP
           clade; Ehrhartoideae; Oryzeae; Oryza.
Chromosome

Chromosome 10

Location

Chromosome 10:14016190..14017943

Sequence Coding Region

14016190..14016822,14016909..14017943

Expression

GEO Profiles:Os10g0403000

Genome Context

<gbrowseImage1> name=NC_008403:14016190..14017943 source=RiceChromosome10 preset=GeneLocation </gbrowseImage1>

Gene Structure

<gbrowseImage2> name=NC_008403:14016190..14017943 source=RiceChromosome10 preset=GeneLocation </gbrowseImage2>

Coding Sequence

<cdnaseq>atggcaatggccaccgccaccgcctcctcctgcgtcgacgccacgtggtgggcgtacgccctcccggcgctcctcggcgccgacaccctctgcgcccacccggcgctgctcgccggcgccgtcctcctggccttcgccaccgccgcggtgctcgcctgggccgcgtcccccggcgggccggcgtgggcgcacggccgcggccgcctcggcgcgacgcccatcgaggggccccgggggctccccgtgttcggcagcatcttcgcgctctcccggggcctcccgcaccgcgcgctcgacgcgatgtcgcgcgacgcggcggcgccacgggcgagggagctcatggcgttctccgtcggggagacgccggcggtggtgtcgtcgtgcccggcgacggcgagggaggtgctcgcgcacccgtcgttcgccgaccgcccgctgaagcgctcggcgcgggagctgctgttcgcgcgcgccatcgggttcgcccccagcggcgagtactggcgcctcctccgccgcatcgcctccacccacctcttctcccctcgccgcgtcgccgcgcacgagccggggcgccaggccgacgccacggcgatgctgtccgccatggccgccgagcagtccgccaccggcgccgtcgtgctccgcccccacctccaggccgccgcgctcaacaacatcatgggcagcgtgttcggccggcgctacgacgtctcctcctcctccggcgccgccgccgacgaggccgagcagctcaagagcatggtgcgcgaggggttcgagctcctcggcgcgttcaactggtccgaccacctcccatggctcgcccacctctacgaccccaaccacgtcgcccgccgctgcgccgcgctcgtcccccgcgtccaggcgttcgtccgcggcgtcatccgcgaccaccgcctccgccgcgactcctcctccaccgccgccgacaatgccgacttcgtcgacgtcctcctctccctcgaggcccacgagaacctcgccgaggacgacatggtcgccgtcctctgggagatgatatttcgtgggacggacacgacggcgttggtgacggagtggtgcatggcggaggtggtgaggaacccggcggtgcaggcgaggctgagggcggaggtggacgcggcggtgggcggcgacgggtgtcccagcgacggcgacgtggcgcggatgccgtacctgcaggcggtggtgaaggagacgctgagggcgcacccgccggggccgctgctgagctgggcgcggctggccaccgccgacgtggggctcgccaacggcatggtggtgccggcgggcacgacggcgatggtgaacatgtgggccatcacccacgacggcgaggtgtgggccgacccggaggcgttcgcgccggagcggttcatcccgtcggagggcggcgccgacgtcgacgtccgcggcggcgacctccgcctggcgccgttcggcgccgggcgccgcgtctgccccggcaagaacctcggcctcgccaccgtcaccctctgggtcgcccgcctcgtccacgccttcgactggttcctccccgacggctcgccgccggtgtccctcgacgaggtcctcaagctctccctcgagatgaagacccctctcgccgccgccgccaccccccgccgccgccgcgccgcctga</cdnaseq>

Protein Sequence

<aaseq>MAMATATASSCVDATWWAYALPALLGADTLCAHPALLAGAVLLA FATAAVLAWAASPGGPAWAHGRGRLGATPIEGPRGLPVFGSIFALSRGLPHRALDAMS RDAAAPRARELMAFSVGETPAVVSSCPATAREVLAHPSFADRPLKRSARELLFARAIG FAPSGEYWRLLRRIASTHLFSPRRVAAHEPGRQADATAMLSAMAAEQSATGAVVLRPH LQAAALNNIMGSVFGRRYDVSSSSGAAADEAEQLKSMVREGFELLGAFNWSDHLPWLA HLYDPNHVARRCAALVPRVQAFVRGVIRDHRLRRDSSSTAADNADFVDVLLSLEAHEN LAEDDMVAVLWEMIFRGTDTTALVTEWCMAEVVRNPAVQARLRAEVDAAVGGDGCPSD GDVARMPYLQAVVKETLRAHPPGPLLSWARLATADVGLANGMVVPAGTTAMVNMWAIT HDGEVWADPEAFAPERFIPSEGGADVDVRGGDLRLAPFGAGRRVCPGKNLGLATVTLW VARLVHAFDWFLPDGSPPVSLDEVLKLSLEMKTPLAAAATPRRRRAA</aaseq>

Gene Sequence

<dnaseqindica>1122..1754#1..1035#atggcaatggccaccgccaccgcctcctcctgcgtcgacgccacgtggtgggcgtacgccctcccggcgctcctcggcgccgacaccctctgcgcccacccggcgctgctcgccggcgccgtcctcctggccttcgccaccgccgcggtgctcgcctgggccgcgtcccccggcgggccggcgtgggcgcacggccgcggccgcctcggcgcgacgcccatcgaggggccccgggggctccccgtgttcggcagcatcttcgcgctctcccggggcctcccgcaccgcgcgctcgacgcgatgtcgcgcgacgcggcggcgccacgggcgagggagctcatggcgttctccgtcggggagacgccggcggtggtgtcgtcgtgcccggcgacggcgagggaggtgctcgcgcacccgtcgttcgccgaccgcccgctgaagcgctcggcgcgggagctgctgttcgcgcgcgccatcgggttcgcccccagcggcgagtactggcgcctcctccgccgcatcgcctccacccacctcttctcccctcgccgcgtcgccgcgcacgagccggggcgccaggccgacgccacggcgatgctgtccgccatggccgccgagcagtccgccaccggcgccgtcgtgctccgcccccacctccaggccgccgcgctcaacaacatcatgggcagcgtgttcggccggcgctacgacgtctcctcctcctccggcgccgccgccgacgaggccgagcagctcaagagcatggtgcgcgaggggttcgagctcctcggcgcgttcaactggtccgaccacctcccatggctcgcccacctctacgaccccaaccacgtcgcccgccgctgcgccgcgctcgtcccccgcgtccaggcgttcgtccgcggcgtcatccgcgaccaccgcctccgccgcgactcctcctccaccgccgccgacaatgccgacttcgtcgacgtcctcctctccctcgaggcccacgagaacctcgccgaggacgacatggtcgccgtcctctgggtaaaaaaaaaaaaaaaaaaacaaattctactcaaacatttcaaactcaaatgtttttttaaaaatgtttttgtgtattttggcaggagatgatatttcgtgggacggacacgacggcgttggtgacggagtggtgcatggcggaggtggtgaggaacccggcggtgcaggcgaggctgagggcggaggtggacgcggcggtgggcggcgacgggtgtcccagcgacggcgacgtggcgcggatgccgtacctgcaggcggtggtgaaggagacgctgagggcgcacccgccggggccgctgctgagctgggcgcggctggccaccgccgacgtggggctcgccaacggcatggtggtgccggcgggcacgacggcgatggtgaacatgtgggccatcacccacgacggcgaggtgtgggccgacccggaggcgttcgcgccggagcggttcatcccgtcggagggcggcgccgacgtcgacgtccgcggcggcgacctccgcctggcgccgttcggcgccgggcgccgcgtctgccccggcaagaacctcggcctcgccaccgtcaccctctgggtcgcccgcctcgtccacgccttcgactggttcctccccgacggctcgccgccggtgtccctcgacgaggtcctcaagctctccctcgagatgaagacccctctcgccgccgccgccaccccccgccgccgccgcgccgcctga</dnaseqindica>

External Link(s)

NCBI Gene:Os10g0403000, RefSeq:Os10g0403000